-
_Need help? Please review [how to read a Staging Review ticket](https://depo-platform-documentation.scrollhelp.site/collaboration-cycle/anatomy-of-a-staging-review-issue-ticket). Tag `@platform-govern…
-
- [x] This is not a support question, I have read [about opensource](https://www.powerdns.com/opensource.html) and will send support questions to the IRC channel, [GitHub Discussions](https://gith…
-
Review all git repos used in initial set of layered BOMs and validate README is correct and up to date
- [ ] Check it is not using the template readme
- [ ] Update to be correct
- [ ] Validate wi…
-
- Program: Authoritative
- Issue type: Bug report
### Short description
Remote backend does not support ALSO-NOTIFY metadata
### Environment
- Operating system: Ubunt…
rage4 updated
9 months ago
-
- Program: Authoritative
- Issue type: Bug report
### Short description
Lua2 backend does not support ALSO-NOTIFY metadata
### Environment
- Operating system: Ubuntu …
rage4 updated
9 months ago
-
- Program: Authoritative
- Issue type: Bug report
### Short description
Lua2 backend does not support NOTIFY functionality
### Environment
- Operating system: Ubuntu 14.0…
rage4 updated
9 months ago
-
# To do:
Write your names and branch of what you're writting in a sublist item
* [x] Move notebooks to content folder, make other required folder(s). @mathieuboudreau https://github.com/qMRLab/q…
-
## Expected Behavior
This is my input.csv file:
```
id,sequence
heterodimer_2,MAAEAWRSRFRERVVEAAERWESVGESLATALTHLKSPMHAGDEEEAAAARTRIQLAMGELVDASRNLASAMSLMKVAELLALHGGSVNPSTHLGEISLLGDQYLAERNAGIKLLEAG…
Nuta0 updated
1 month ago
-
- [x] I have verified that the issue occurs with the latest twilio-video.js release and is not marked as a known issue in the [CHANGELOG.md](https://github.com/twilio/twilio-video.js/blob/master/…
-
I need a way to set different request timeouts without using multiple connection pools. Tedious has a `setTimeout` function on `Request` that implements this behavior, but there's not a defined wa…