-
Just mentioning this here in case you were looking for an edge case to include in your testing or something like that.
The website doesn't parse this very long CIF file of this `C110 H106 Ge2 Li2 N…
-
```
Hello,
First of all thanks for your work.
I can't get cifs manager working.
I tried to manually load the cifs module using adb shell and had the following
output :
root@android:/etc/init.d # ./…
-
There's an SMB2 FS on aminet, would it be possible to join forces / converge?
If I understand correctly, this one is SMB1 only, and many many NAS boxes don't support SMB1 anymore :(
-
**Steps to reproduce**
1.Create SMB / CIFS external storage with option “Log-In credentials, save in session”
2.Use Collabora online to open any Office file from this storage.
**Expected behaviou…
-
I would like to measure CIFS Performance of a mounted CIFS Share on my nodes. It would be nice if node_exporter could support CIFS Performance measuring via https://www.systutorials.com/docs/linux/man…
-
## Expected Behavior
I would like to reuse a template folder for multiple ColabFold runs.
So I run ColabFold first on the following input sequence:
`>seq
EIVLTQSPGTQSLSPGERATLSCRASQSVGNNKLAWYQQR…
-
I struggled all day yesterday with this. Could you help me come up with a `docker volume create` command that satisfies the following requirements?
## Requirements
* type: `cifs`
* username: `u…
-
### Description
Hi Alex and developers,
I bought you two coffee so that you have something to drink while looking into my issue.
I am having trouble with a fresh install of the Immich-addon (v1.1…
-
CIF users are generally encouraged to explicitly specify the CIF dictionary that their CIF files conform two. The same approach should be used in the example CIF files provided in this repository.
…
-
@Kalharap Here is the code to generate the cif file for the molecular centers
```python
from pyxtal import pyxtal
for file in ['cifs/ACSALA.cif', 'cifs/ACSALA13.cif']:
f1 = pyxtal(molecular=…