-
I think it would be great if all the ODE/DAE solvers could be called through the same interface. This would essentially mirror the approach of https://github.com/JuliaOpt/MathProgBase.jl . Would it …
-
violates x-disjoint.owl (more on this file at the workshop)
reason: part of extracellular region and part of cell
Reported by: cmungall
Original Ticket: [geneontology/ontology-requests/9076](https:…
-
The differentium between lytic vacuole, and its subtype, lysosome is not clear:
GO:0000323 ! lytic vacuole [DEF: "A vacuole that is maintained at an acidic pH and which contains degradative enzymes, …
-
Hello,
I'd like to request the following biological_process term:
hyperostosis
def: The excessive growth of bone.
definition ref: wikipedia
relationships: is_a: developmental growth involved in mor…
-
I'm running gozim with wikipedia for schools, and whenever a link with parenthesis (or any symbol, really) in the title is clicked, I get a 404 error For example, the page titled "0 (number)" causes e…
-
Definition: A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organi…
-
I wonder why 'necrotic cell death' is not a GO term. It seems that it should be a sibling of apoptosis.
http://www.ucihs.uci.edu/anatomy/histo/Old\_Files\_2005/corenotes/celldeath2004.pdf
Necrotic ce…
-
Zinc-finger protein binding
Definition: Interacting selectively and non-covalently with a protein containing a Zinc finger domain. Zinc finger domains are relatively small protein motifs that contai…
-
GO:0042633 hair cycle has the rule "only_in_taxon 40674 Mammalia"
but there is IEA from Ensembl Compara, so I would like to add the specific taxon restriction
GO:0042633 hair cycle never_in_…
-
I found an instance where a stop codon is retained in the export in WA2.0
```
>SINV10883a-00001
LVSMSMEYLVLRLRPLAGIRRAPDNLRRLRRETQLRPFYAHRVASRHVASRRASRHVSSRHFTSRHITATK*EDSTRRSVIECRSVDLGRRAILAKICWNFRL…