-
I'm trying to understand how to run the `cite-seq-count` with data made with the 10x protocol for Next GEM Single Cell 3' HT v3.1.
Reading the user manual for the tool, I should run the command wit…
-
## General information
- Terminal program: alacritty 0.9.0
- Operating system: NixOS
- ZSH framework: antibody (but I could reproduce this issue even with plain `source`)
- ZSH version: …
-
*Issue migrated from trac ticket # 5790*
**component:** help | **priority:** blocker
#### 2021-03-20 19:59:34: joanne.m.yancon@thermofisher.com created the issue
___
> Thermo Fisher Scientific is …
-
A legend for the highlighting of the different antibodies could be very usefull and might enable other features like colored connections between the antibodies upon selecting an antibody.
-
Currently `convert_to_ometiff.py` adds the antigen names, taken from the Cytokit YAML config (in turn taken from the submitted channel names array), to the `Channel` element `Name` attribute. However,…
-
anarci supports 2 domains in one sequence, while abnumber does not
abnumber.exceptions.ChainParseError: Found 2 antibody domains in sequence: "DIQLTQSPSFLSASVGDRVTITCSARSSISFMYWYQQKPGKAPKLLIYDTSNLA…
-
For any "public" API response from either search-api or entity-api, i.e. GET requests that support public responses when there is either no token provided or a valid token without membership in `HuBMA…
-
Teď funguje tak, že máme
```python
@dataclass
class AntibodyMatchForHLAType: # TODO: možná lepší název bude AntibodyMatchForAssumedHLATypes
assumed_hla_types: List[HLATypeWithFrequency]
…
-
Kristian just explained what's going on in [this](http://journals.plos.org/ploscompbiol/article?id=10.1371/journal.pcbi.1004870) paper, and it turns out to be precisely what we need to do with unseede…
-
Follow-up to #149:
Add high level documentation to "transport" module
1. What problem are we trying to solve here?
2. What's the difference between surrogate outcomes and transportability?
3. …