-
# Stories
* As provider I want to stop a new Gardener roll-out when it detects issues during cluster operations that indicate a problem with the new Gardener version, so that the damage it contained …
-
I am having the following issue
```
### writing best and last embs to graphmb_bins
Uncaught exception
Traceback (most recent call last):
File "/work/ese-alexp/software/python/anaconda3/2021.1…
-
I have been following Reloader for the PR : https://github.com/stakater/Reloader/pull/486
Issue : [Reloader Issue Support for Cron Job ](https://github.com/stakater/Reloader/issues/452)
Is there a r…
-
I ran the default python SAUCIE.py (default settings) on two datasets (with clustering and batch correction), which gave only "0.0" cluster annotation for all cells. The SAUCIE embedding was just a li…
-
## Summary
A Kafka sink over a sufficiently large volume of data can fail loop forever if producing the snapshot to Kafka takes longer than the fixed transaction timeout (currently 60s [^1]). We ob…
-
I'm running the test example and the code runs successfully without GPU. But when I use GPU, it has bug likes this:
Generating ESM language model embeddings
['IELTQSPSSLSASLGGKVTITCKASQDIKKYIGWYQH…
-
### Component(s)
_No response_
### Describe the issue you're reporting
We have two collectors tier 1 and tier 2. Tier 1 collectors have a loadbalancingexporter configured for exporting spans …
-
### What happened + What you expected to happen
1. While the example GPU + docker script works (https://github.com/ray-project/ray/blob/master/python/ray/autoscaler/gcp/example-gpu-docker.yaml), a sl…
-
Reporting from the `idea-pool` channel on slack, as discussed with @carmocca.
---
Hi there,
On the way to solve a OOM problem with dynamic batch sizes based on sequence length, I have just d…
-
```[tasklist]
### Tasks
- [x] hardening parsing of basic batches of data partition: configuration & raft_data
- [ ] adding support of archival_metadata batches of data partition
- [x] hardening tx…