-
Firstly, thanks for creating this excellent library. This helps me a lot!
Currently, Miragejs works excellently when it comes to testing React components that interact with external APIs.
My setup…
-
# Tasks
- [ ] Bytecode support (pycdas)
- [ ] Handle new opcodes in AST builder
- [ ] `BINARY_OP_INPLACE_ADD_UNICODE`
- [ ] `EXIT_INIT_CHECK`
- [ ] `FORMAT_SIMPLE`
- [ ] `FORMA…
-
**Describe the bug**
PTP does not seems functional on FRDM-K64F (possibly all NXP ENET?) as of main@35391f3d349935d3a5454ba42990dc586ef8a80f.
**To Reproduce**
Compile and flash `samples/net/g…
-
Perhaps the page can be in landscape orientation
![image.png](https://raw.githubusercontent.com/mafpovbul/pe/main/files/6184dc4d-f034-4ea8-8041-a4a2012b1fc5.png)
-
**Note from the teaching team:** This bug was reported during the _Part II (Evaluating Documents)_ stage of the PE. **You may reject this bug if it is not related to the quality of documentation.**
Pe…
-
Hello thanks for this awesome library.
On a ESP32-WROOM-32S development board, I managed to play a sound sample using the sequence.
Now i have a function that should make the following happen in …
-
Hello,
Is it possible to have a sequencer and/or arpeggio engine for squares and circles?
-
The following two lines yield an exception on Mac and Ubuntu 20.04 (jdk 1.8). Have had a similar issue when trying to use MidiSequence with Parts. Perhaps this is as simple as a missed "open" statem…
-
In the sidebar, add sequence number to the slides so you can know the order of that element in the presentation
-
Hi,
I just realized that cablastp-extract appends `*` characters to my protein sequnces:
Input
```
>tr|R4XQ05|R4XQ05_ALCXX
MTMDSTIYLTLWAVLAFVSWLIVAGGAVLAVFSRAIKDTTFERIGLAAVSLTATGAACRIFMAGWASAGDAALAA
…