-
I often still write python as though it were FORTRAN, but there's no compiler to save me anymore. Hence, there are a bunch of places where relatively low-level python optimsation is possible.
For …
-
I am implementing the [tridiagonal matrix algorithm](https://en.wikipedia.org/wiki/Tridiagonal_matrix_algorithm) (TDMA) to solve many tridiagonal systems of the same shape in two sweeps (one forward a…
-
### Proposal
This is a fairly loose proposal for a feature that imo could be very useful, but it doesn't have to be done anytime soon.
Currently, gym uses a rather messy stateful OOP approach, …
-
i am running alphafold v2.3.2 to predict a multimer on 16CPU,241G,4* V100
```
>3JA9_1|Chains A|Proliferating cell nuclear antigen|Homo sapiens (9606)
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHV…
-
Hello,
When solving the (trivial) SDE $d y_t = -y_t\ dt + 0.2\ dW_t$, the Diffrax Euler solver is ~200x slower than a naive for loop. Am I doing something wrong? The speed difference is consistent …
-
Hey,
I can see how brax can be used to differentiate with respect to the system state. I wonder if there is a nice way to also diff wrt, e.g., the mass of a body. Taking the basic tutorial as an ex…
-
Currently the only RESt framework supported by the extension is RestEasy, but if for example you are using Apache TomEE you would like to run your client tests with Apache CXF (so no more dependencies…
-
Hi,
I've finished the featuring step and got the output feature.pkl for the multiple prediction. Then I got these error messages:
(parafold) [linx@localhost ParallelFold-main]$ I0803 08:18:26.62…
-
I was wondering if the equinox community has good advice / best practices for creating dataloaders that work well with jax? I've done some stuff from scratch but I tend to find that the training (on G…
-
I installed Tfold and ran it. But I got the following issue. Can you let me know how to solve it? Thank you.
$ ./run_alphafold.sh
2024-07-16 10:13:16.461777: I tensorflow/stream_executor/platform/…