-
### SQLDelight Version
2.0.2
### Operating System
Mac arm64
### Gradle Version
8.8
### Kotlin Version
1.9.0
### Dialect
SQLite
### AGP Version
_No response_
### Describe the Bug
Compilati…
-
**Describe the bug**
Since OpenROAD, Yosys, Klayout etc. are installed within the IIC-OSIC-TOOLS, I tried to run the OpenROAD-flow-scripts (ORFS) using the already installed tools.
**What I did**
…
-
hello ! I've got a problem with ColabFold: AlphaFold2 using MMseqs2 , when I use the sequence of a-synuclein (MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSI…
-
Because of increased chain attack, we are avoiding to use this extension on dev-machine, because this package has 3 dependencies (`applicationinsights` is heaviest among them), and after looking throu…
-
To be mindful of our project's dependencies, let's track some basic stats. Bots can look through the actual git history.
These numbers are absolute totals at each commit. (meaning, don't add number…
-
### What happened + What you expected to happen
Tasks with `num_gpus` set to a non-zero value don't seem to be having their profile events recorded and hence don't show up on the Ray timeline.
Min…
-
Hi, awesome project. I was wondering if you've considered using nyctal as a backend. zero-dependency wayland compositor meant to be used as the basis for larger projects.
https://github.com/s-rah/nyc…
-
New metric to be added to phase 1 code
The fraction of dependencies that are pinned to at least a specific major+minor version (see phase 2 specs).
-
Whether I use the option with remotes and github or the option to use binaries all the installs failing for the critical dependency "rxode2ll" with this error below during compilation.
```
e
llik…
-
I want to test flask package with pynguin, however pynguin cannot deal with relative imports (i.e., cannot import relative modules of flask). Can you give me some advice on how to solve this problem?