-
### Describe the bug
When trying to adapt the color schemes of Custom Container's I noticed a slight inconsistency in how color functions are used, which led to some initial confusion.
The `vars…
-
### Issue summary
Caffe doest not build with opencv 4.0.1 (which is the latest opencv at the time of writing). This was identified as part of Homebrew testing: https://github.com/Homebrew/homebrew-…
-
```
/home/linuxbrew/.linuxbrew/Homebrew/Library/Homebrew/dependencies.rb:39: [BUG] rb_vm_insn_addr2insn: invalid insn address: 0x00000080
ruby 2.6.6p146 (2020-03-31 revision 67876) [i586-linux-musl]…
tbodt updated
4 years ago
-
## Expected Behavior
## Current Behavior
Here's the `rep_seq.fasta` file:
```
>protein_A
MKNNSQDQQKLLKLLLQKKGISFKKVNTIPKRQSSNSELIPISLTQLELWFFAQFYPENC
IYNLPCIYRIEGLLNVPALEESLREIVKRHESLRTTFTCI…
-
"@candlefinance/faster-image": "1.6.2"
on iOS 17 (both device and simulator), calling `clearCache()` seems to only partially work. I don't see a pattern, but some (most?) of the sources do indeed …
-
### Steps to reproduce
Link to live example: https://codesandbox.io/p/devbox/c3cn8j?migrateFrom=4jx2y2
Steps:
1. In the live example, click on the DatePicker box to focus it.
2. Notice that the…
-
### Build tool
Vite
### Where do you see the problem?
- [X] In the browser
- [ ] In the terminal
### Describe the bug
npm run build generated an unnecessary .vite folder. It lead error in Edge Ex…
-
Hello,
wenn ich die Transkription starten möchte, erscheint sofort eine Fehlermeldung:
"[Errno 86] Bad CPU type in executable: '/Applications/noScribe.app/Contents/Frameworks/ffmpeg'"
Wie lässt …
-
### Description
Attempting to start `--network-address` fails. Additional starts without the flag fail with a different error message. Removing `~/.colima` allows for a successful start, without the …
-
$ pwd
/workbench-images/base
$ make all RELEASE=2024c DATE=20240808
Podman Terminal output, running this on Mac OS X ... should not matter though because yum runs inside centos stream 9, `quay.io…