README.md typos: #antibody-sequence-embedding

[seanryanchan]

Nitpicky, but typos are typos. The demo code below contains a small typo:

from igfold import IgFoldRunner

sequences = {
    "H": "EVQLVQSGPEVKKPGTSVKVSCKASGFTFMSSAVQWVRQARGQRLEWIGWIVIGSGNTNYAQKFQERVTITRDMSTSTAYMELSSLRSEDTAVYYCAAPYCSSISCNDGFDIWGQGTMVTVS",
    "L": ```
"DVVMTQTPFSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPYTFGGGTKLEIK"
}

igfold = IgFoldRunner()
emb = igfold.embed(
    sequences=sequences, # Antibody sequences
)

emb.bert_embs # Embeddings from AntiBERTy final hidden layer (dim: 1, L, 512)
emb.gt_embs # Embeddings after graph transformer layers (dim: 1, L, 64)
emb.strucutre_embs # Embeddings after template incorporation IPA (dim: 1, L, 64)

the last line needs to be fixed. emb.strucuture_embs -> emb.structure_embs

[jeffreyruffolo]

Thanks, now fixed!