Unable to display protein sequence

[kegelken]

I recently noticed that, using the exact same code as before, protein sequences are not showing anymore. I am using following example code:

<script type="text/javascript" src="https://cdn.jsdelivr.net/npm/regenerator-runtime@0.13.3/runtime.min.js"></script>
<script type="text/javascript" src="https://unpkg.com/seqviz"></script>

<div id="seq_root"></div>

<script>
window.seqviz.Viewer("seq_root", {
        "name": "TNF_partial", 
        "seq": "mstesmirdvelaeealpkktggpqgsrrclflslfsflivagattlfcllhfgvigpqr", 
        "viewer": "linear",
        "showIndex": true,
        "style": {height: "calc(300px)", width: "100%" }, 
        "zoom": {linear: 50, circular: 10 }, "rotateOnScroll": false
}).render();
</script>  

Using this code, following is seen on the screen:

The sequence itself is present, can be selected and copied but the letters itself are not displayed.

Please advice on how to solve this issue. Kind regards

[jjti]

hey @kegelken, sorry about, I think it's fixed now in the latest patch. Eg here: https://codesandbox.io/s/seqviz-2034785vi2ht-forked-9du0eg?file=/src/App.js

release of new patch here: https://github.com/Lattice-Automation/seqviz/releases/tag/3.7.12

[jjti]

@kegelken please let me know if you run into this again or more issues

[kegelken]

@jjtimmons indeed, everything is displayed as expected! Thank you so much for the quick response and fix!