I found another small bug in NeoRecoPo.py using a reformatted neoantigens.Indels
Problem stacktrace:
INFO: Begin.
Traceback (most recent call last):
File "/home/davide.rambaldi/src/NeoPredPipe/StandardPredsClass.py", line 260, in __extractSeq
pos = int(seq_record.id.replace(";;", ";").split(";")[5]) - 1
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
ValueError: invalid literal for int() with base 10: '(position'
During handling of the above exception, another exception occurred:
Traceback (most recent call last):
File "/home/davide.rambaldi/src/NeoPredPipe/NeoRecoPo.py", line 135, in <module>
main()
File "/home/davide.rambaldi/src/NeoPredPipe/NeoRecoPo.py", line 98, in main
preds.ConstructWTFastas()
File "/home/davide.rambaldi/src/NeoPredPipe/StandardPredsClass.py", line 195, in ConstructWTFastas
self.__addToFastaFile()
File "/home/davide.rambaldi/src/NeoPredPipe/StandardPredsClass.py", line 169, in __addToFastaFile
seqID, seq = self.__extractSeq(sam, fasta_head, epitopeLength) # WT seqID and seq
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
File "/home/davide.rambaldi/src/NeoPredPipe/StandardPredsClass.py", line 262, in __extractSeq
pos = int(seq_record.id.replace(";;", ";").split(";")[6]) - 1
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
ValueError: invalid literal for int() with base 10: '10-407'
This is due to this entry in fastaFiles reformat.fasta
a = 'line3751;NM_000537;c.27delC;p.W10Gfs*37;protein-altering;;(position;10-407;changed;from;WGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR*;to;GDCCCCSGAPVPLVSRQTPPPLNGSSSRECPQSEKA*)'
int(a.replace(";;",";").split(";")[6])
ValueError: invalid literal for int() with base 10: '10-407'
If you tell me which of the two integers I should use, I can propose a pull request with a small change in StandardPredsClass.py
Hello! Hope you are well.
I found another small bug in NeoRecoPo.py using a reformatted neoantigens.Indels
Problem stacktrace:
This is due to this entry in fastaFiles
reformat.fasta
In fact if I try this in console it fails:
If you tell me which of the two integers I should use, I can propose a pull request with a small change in StandardPredsClass.py
Best Regards
Davide