Merck / BioPhi

BioPhi is an open-source antibody design platform. It features methods for automated antibody humanization (Sapiens), humanness evaluation (OASis) and an interface for computer-assisted antibody sequence design.
https://biophi.dichlab.org/
MIT License
131 stars 44 forks source link

Error: Invalid sequence for "antibody" #34

Open BobW4ng opened 1 year ago

BobW4ng commented 1 year ago

Error: Invalid sequence for "Antibody1": "QVQLVQSGGGVVQPGRSLRLSCKASGYTETRYTMHWVRQAPGKGLEWIGYINPSRGYTNYNOKVKDRFTISTDKSKSTAFLQMDSLRPEDTAVYYCARYYDDHYCSSASCFCLDYWGQGTPVTVSS" I dont know how to deal with this issue , It would be much appreciated if this solves the problem,thanks guys!