[BUG]Error: Invalid parameter count for option '--query'

[diego00012138]

Describe the bug A clear and concise description of what the bug is. Error: Invalid parameter count for option '--query' Input The command-line input you used to run your data. rgi main -i ./prodigal/protein.fa -t protein -n 12 -a DIAMOND --include_loose -o ./card/output.card

Input file The file you used as an input to run the data. Either paste a sample or upload the file. error occurs when put in this :

k97_81242_1 # 1 # 381 # -1 # ID=1_1;partial=11;start_type=Edge;rbs_motif=None;rbs_spacer=None;gc_cont=0.362 VFNFPKVKKEQVKQFQLFDYPKIYDHYKCNSIFGYGDPNQNEANKLLNFYNAKLGRSKEV RMIILIFRGQPLDAGFLQEGYWKRGNKNEFITTIGIDSENTVQWSYVFSWTESESLITET RNFVLGQ but it is ok when put in this : k141_288077_1 # 14 # 343 # -1 # ID=1_1;partial=01;start_type=Edge;rbs_motif=None;rbs_spacer=None;gc_cont=0.570 VHWGNEMTPTPTPEQRELSKRWIDAGASAIIGGHPHVTQTIDSYRGRPIVYSLGNFVFDY YPVDPAIWYGWAIRLSIPPQSPDGSTPIDWETITVELDPRGLPKPVDPN Error log The error that is thrown when you run the process.

CARD Version The version of CARD you are using. Please ensure it is up to date.

RGI version The version of RGI you are using.

Expected behavior A clear and concise description of what you expected to happen.

Screenshots If applicable, add screenshots to help explain your problem.

Desktop (please complete the following information):

• OS: [e.g. iOS]
• Browser [e.g. chrome, safari]
• Version [e.g. 22]

Additional context Add any other context about the problem here. If applicable, include dependency versions such as Biopython version and Python version.

[diego00012138]

actually i find an interesting question. The file "K97" was stored in a hard disk, and it can not be input, but it do can when i move it to the storage of my server.

[raphenya]

@diego00012138 Are you inputting valid FASTA formatted files?

[github-actions[bot]]

Issue is stale and will be closed in 7 days unless there is new activity