search

facebookresearch / esm

Evolutionary Scale Modeling (esm): Pretrained language models for proteins
MIT License
3.16k stars 627 forks source link

HTTP Error 403: Forbidden: "esm1v_t33_650M_UR90S_1-contact-regression.pt" #108

Closed Licko0909 closed 3 years ago

Licko0909 commented 3 years ago

Bug description Halo~, Dear developer. I cannot download this file, "esm1v_t33_650M_UR90S_1-contact-regression.pt", log like the following: image

Code python variant-prediction/predict.py \ --model-location esm1v_t33_650M_UR90S_1 esm1v_t33_650M_UR90S_2 esm1v_t33_650M_UR90S_3 esm1v_t33_650M_UR90S_4 esm1v_t33_650M_UR90S_5 \ --sequence HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW \ --dms-input ./variant-prediction/examples/BLAT_ECOLX_Ranganathan2015.csv \ --mutation-col mutant \ --dms-output ./variant-prediction/examples/BLAT_ECOLX_Ranganathan2015_labeled.csv \ --offset-idx 24 \ --scoring-strategy wt-marginals

tomsercu commented 3 years ago

Seems like a version issue; can you update the installed esm to the latest version? The regression weights do not exist for the esm-1v models, but the logic around silently ignoring these failures changed. To debug this: you should be able to run pytest tests/test_load_all.py without failures on the esm-1v models.

Licko0909 commented 3 years ago

Thanks you! Problem solved!

tomsercu commented 3 years ago

Great! closing this issue