AttributeError: module 'deepspeed' has no attribute 'comm'

facebookresearch / esm

Evolutionary Scale Modeling (esm): Pretrained language models for proteins

MIT License

3.16k stars 627 forks source link

AttributeError: module 'deepspeed' has no attribute 'comm' #652

Open YvetteJxy opened 8 months ago

YvetteJxy commented 8 months ago

When I run the example given in readme:

model = esm.pretrained.esmfold_v1() model = model.eval().cuda() model.set_chunk_size(128) sequence = "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG" with torch.no_grad(): output = model.infer_pdb(sequence)

I have encountered an error : module 'deepspeed' has no attribute 'comm'. And this error originated from 'output = model.infer_pdb(sequence)' .

I am very confused why this problem happens and do not know what to do.

awer-A commented 7 months ago

Please tell me if you solved this error

YvetteJxy commented 7 months ago

@awer-A Maybe you can try to update the deepspeed version to 0.7.0. and I hope it will work. If you have any other questions, please let me know.

awer-A commented 7 months ago

@YvetteJxy Thank you very much for your reply. Now it can run successfully,But the pLDDT result I obtained is 49.75926877470356. Do you know what could be the reason?