search

hyattpd / Prodigal

Prodigal Gene Prediction Software
GNU General Public License v3.0
445 stars 85 forks source link

Millions of null characters (\x00) inserted into called gene #21

Closed smdabdoub closed 8 years ago

smdabdoub commented 8 years ago

In the output FASTA file from prodigal, one entry has 122 million null characters inserted into the middle of the called gene:

[('\x00', 122748928), ('V', 7), ('A', 6), ('L', 5), ('S', 5)]

ENVKHIWGRAQWLMPVIPALWEAKAGGSPEVR\x00...\x00ASSLWGLALVSYVEMNESHTPVCV

hyattpd commented 8 years ago

In order to tell if this is a bug, I'd need the input sequence and to know what version/OS you're using.

smdabdoub commented 8 years ago

Apologies, I went hunting for additional information and forgot to update this issue.

I ended up re-running prodigal on the data and the null characters disappeared. So I'm chalking it up to cosmic rays.