lbl-cbg / t5-commons

Code required for the Taskforce5 commons project.
1 stars 0 forks source link

Add disorder prediction analysis to initial protein analysis pipeline #1

Open ajtritt opened 9 months ago

ajtritt commented 9 months ago

As proteins come in for structural prediction, we need to run protein disorder prediction along side AlphaFold. Susan runs disorder prediction using CCD, but I think we can get away with just running one disorder prediction tool, like IUPRED.

I downloaded the IUPRED code, and ran it locally using the following protein. I have verified that that the result returned by CCD is the same produced by the IUPRED command line tool.

>test
MSDVTDKCIASKAADLLTVMSTPDAETPSLCMHTDSTCRYHGSVAVYQDVYAVHAPTSIYYQALKGVRTIYWIGFDTTPFMYKNMAGAYPTYNTNWADESVLEARNIGLGSSDLHEKSFGKVSIMRKKKLQPTNKVIFSVGSTIYTEERILLRSWHLPNV