search

lifuyi774 / ProsperousPlus

3 stars 1 forks source link

the different result between webserver and local standalone software #2

Open asmalldream opened 2 months ago

asmalldream commented 2 months ago

I tested the server version and the local version, and found inconsistent results for the same sequence. example: The sequence is：CMYKCVVRVCGGCWTFWPPWNCHCMYKCVVRVCG The protease is：A01.001 Snipaste_2024-04-23_16-56-52

What could be the possible issue? Is this irreproducibility caused by the possible existence of random seeds in the model?