search

salesforce / progen

Official release of the ProGen models
BSD 3-Clause "New" or "Revised" License
617 stars 114 forks source link

Generate sequence based on natural one #18

Open avivlazar opened 1 year ago

avivlazar commented 1 year ago

Hi, First of all, thank you for sharing ProGen2 code. I read the article as part of my thesis, and started playing with the model.

My questions: 1) How may I generate a new sequence by ProGen2 which based on natural sequence? For example: Natural seq: "DQSVRKLVRKLPDEGLDREKVKTYLDKLGVDREELQKFSDAIGLESSGGS" A new generated seq: "GSSDIEITVEGKEQADKVIEEMKRRNLEVHVEEHNGQYIDKASLESSGGS"

2) In generation process, is it possible to define which station/s in natural sequence I want ProGen2 will change? if yes - how? Example: I want to change only the 3rd station in sequence, so: Natural seq: "DQSV..." Possible generated sequence: "DQGV..." So the 3rd station "S" was changed to "G".

Best Regards, Aviv.

Dongchengzhi commented 1 year ago

Hello, they are also currently my questions. Have you solved these problems?

xubocheng commented 1 year ago

I also have these questions.

Solstice-Pan commented 9 months ago

Hello, they are also currently my questions. Have you solved these problems?