Skipped ngrams in get.phrasetable()?

[szhang1121]

I tried to do 4-gram on the Bloom73 corpus at the character level. Although "h o r i " was part of the input sequence (verified with grepl("h o r i ", Bloom73)), "h o r i " wasn't in the phrase table generated from get.phrasetable(ngram(Bloom73, 4)). Did I miss anything?

[wrathematics]

I'm not familiar with the Bloom73 corpus. Can you give a link?

[szhang1121]

Hello Dr. Schmidt,

Thanks a lot for the reply!

Attached is the bloom73 corpus I used. I imported it as a single string of the text in R.

And here is the code I used for getting the character level 4-grams. It seems that "h o r i " was not in the table returned from get.phrasetable:

bloom73 <- gsub('\.','',bloom73) bloom73 <- splitter(bloom73,split.char = T) bloom73_4grams <- (get.phrasetable(ngram(bloom73,4)))

Please let me know if you need any additional information. Thanks again for developing the package and for your help!

Best regards,

Susu Zhang, Ph.D. Postdoctoral Researcher Columbia University Department of Statistics

On Thu, Aug 30, 2018 at 9:27 AM Drew Schmidt notifications@github.com wrote:

I'm not familiar with the Bloom73 corpus. Can you give a link?

— You are receiving this because you authored the thread. Reply to this email directly, view it on GitHub https://github.com/wrathematics/ngram/issues/6#issuecomment-417318999, or mute the thread https://github.com/notifications/unsubscribe-auth/Agw8pLDRVMbovgLWQ1vjLIF4owtXRsHeks5uV-hSgaJpZM4WSYeW .

uptherechairawaychairdownwhatsthatwhatdadawheresdadadadaworkingwheresmamatherewhatsthatthatsamicrophonenothatsawirerightwedontplaywithwiresdowedowncarefulmoretheredownallisonwhatisthischairyesdowndownyousitdownawaydowndownletsseewhatkindoftoyswebroughttodayletsseewhatsinhereletsseewhatkindoftoyswebroughtwithuswhatsinthebagwhatsinthebagwhatdoyouseewhatplayisthatwhatyouresayingplaycookieshallwehaveacookieokayletshaveasnackwellwellhaveasnackletshaveasnackletssitdowndownoverheresitdownandhaveasnackthatsagirlthatsagirlheressomejuiceheresacupforallisonandacupformommymommyletsbringthemicrophoneoverwhatsmommyhavecookieokayheresacookieforyoutheresmoreinherewellhaveitinalittlewhileohnowletssavetheseforlateryoueatthiscookiewellsavethisoneforlateryoureahungrygirlyoureahungrygirlmmlittlebitofjuicewheresyourjuiceisitgonewellhavesomecookiesihavesomehereohyouspilledthejuiceyeahuhohohwellwipeituphowsthatcookiemmithinkyoureahungrygirlmorejuicewheresthejuicegoneithinkmommywillhavesomejuiceillgiveyousomemorehereillgiveyoumoretherecarefulthatssharptherewheresthecookiegonemorecookiewhatdarlingcookiedirtyyouthinkthatsdirtyokaywellthrowitawaythatsthemicrophonesweetheartwellleavethattherewellleavethatrighttherethatsanothermicrophonemicrophonemicrophonetherebabyahisthatyourbabyareyougivingherakissthatsverysweetohwhatsthematterwhatsthemattermorecookieohdarlingwedonthaveanymorecookieswedonthaveanymorethatsallweatethemwellhavemorewhenwegohomethatsacleanonetherearenomorecookiesthecookiesaregoneheresmorejuicewouldyouliketofinishthatjuiceshallihelpyoushallihelpyouthereokaythisisforthisisformommynoallisongonnahaveitthenmommyllhavethisokaythatsmommysjuicethatsmommysjuiceohmommydoesnthaveanyjuiceohthankyouallgonemoreohyouspilledituhohillhavetogetatissuemommywillhavetogetanothertissueputthisawayokaysavethiscupforlatermommyllgetatissueohitsamessyoumadeamesshahayouthinkthatsfunnyyyyyyymoreohwellhavesomealittlelaterheylookyourbabyfelldownwhatdarlingohwhatshouldidoohpoorbabyputthebabyinthetruckokayshellgointhetrucktheresheisohwhatsthematterthebabycryingchairisthatwhatyouresayingtherebabyohohwheresthebabydownwantthebabytositupisthatwhatyouwantuhohdownisbabyhappyuhohlookwhatmommyhaslookwhatihavegirlthatsapictureofagirlareyoushowingittoherwheresthegirlgirlnotheresnopicturebackthereisitwheresthegirltheretheredownheylookwhatmommyfoundlookwhatihaveinthecarlookwhatelseihaveinthebagcarcartheresyourcartheresyourcarwhatdoyouheartelephonedoyouhearthetelephonethinkthatsdadawheresdadadaddyworkingwheresthelittlemanwhoridesthecarwhoridesthecarishegoneseeifyoucanfindhimwhereisheishegonetherecarawaythereitgoesstopmorestopmorebabytheresthebabyupuhmygoodnesswhatsthebabysayohisthebabysadtheresheisshessittingwheresthebabywellshewenttoanswerthetelephonedarlingisthebabystillcryingwellwhydontyougiveherakissohshesahappybabythereuhohmmdownheylookwhosherehawhatsthatthatsthebunnyrabbitnowellimsorrycantplaywiththemicrophonenononononowherestherabbitgonemorewhereshesgonethereheisturnyouknowwhatmommyhasihavesomethingyouveneverseenbeforewehavesomebubbleswouldyouliketohavesomebubblesrememberbubblesinthebathtubicantgetthestickoutxxxletsseemmwatchmissedicantdoitokaytryagainlittlebubblesyoudidntseethosehereitgoesgoneohgonemoreuhmissedgoneohdidisplashyourfacemoreohicantdoitgoneohallgonewouldyouliketoputthetoponthebottlewouldyouliketoputthetoponthebottlehuhnowhatdoyouwantwhatdarlingnowhatdoyouwantmoreokaymommylltrytodosomemoreilltrytodosomemoreuhohicantdoiticantgetthemoutitsveryhardokayletstryitagainletsseeletstryagainheretheygonoitdoesntworkgonemoreshouldwecoveritupokayletscoveritupandputitawaywellcoveritupandputitawaywhatdarlingwhatdoyouwantmommytodoopenitupopenitokayletsseeifwecantryokayilltryagainimnottoogoodatitthoughtheresalittlebubblecanyoublowuhstopmmohgoneallgonemoreokaylasttimestickythatdoesnttastegoodletscoveritupsweetheartwellthatsallwerenotgonnaplaywithitanymorewerenotgonnaplaywithitanymoreyouknowwhatithinkweoughtoughttodoohyouknowwhatelseihaveyouknowwhatelseihavenoidonthaveanycookiessweetheartlookwhatibroughtupwhatchairwhatawaymicrophonedownupmommyoffthatchairwheresyourbabygonedownlookwhatihaveihaveababycowohareyougivinghimakissthatsverynicewhatsthatthatwhatsthatyeahwhatsthatthatsabigcowheresonecowheresabigcowtheresacowandwhatsalittlecowuhohcowpigpigyeahthepigfellovertheresthepigohwhatsthatwhatsthatwhatdarlingnononoitsamicrophonewhatsthatisthatapigthatsanothercowgonethatsalltherearemorewantmoreidontseeanymoredoyouseeanymorenoyoudancingchairitsalittlechairwhatdownokayillhelpyoudownyougowhatwhathavewegotletsputtheletsputthecowsonthetableletsputthecowsonthetableshallwetheremorerightmoreletsputthecowsonthechairletsputthecowsonthechairthereyouaredownwanttogetdownnowdownyougoletsputthecowsonthechairletsputthecowsonthechairnoithinkthecowswanttositonthechairohsitsitokaywellillputthiscowonthischairchairthepigdowncanyouputthepigunderthechaircanyouputthepigunderthechairitisaboxshallwesitonthefloorseewhatisinitwhatisthatwhatdarlingthatisamicrophonethemanputthemicrophoneonmommyboxwhatdoyouthinkisinthatboxthemanputthemicrophoneonrightonmommyrightwhatisintheboxcanyouopenitcanyouopenitboxwellmommyisgonnaseewhatisinitohallisonlookwhatiseeohmorewellwhydontyoutakethemoutletsseewhattheyareohdoyouknowwhatthatiswhatisthatthatisalambyeahmaryhadalittlelambrightwhatisthatpigseewhatelseisintheboxhorsebigyeswhatdarlinghorsemmwhatshouldidowithitpighereisapigmaryhadalittlelambmoocowisthatthebabyisthatthebabynoitisapigmanthatisthemicrophonethatisthemicrophoneyeahmommyhasamicrophonethatisanothermicrophonewhatthatisaladyhmmthatisamanwhereisdaddyofficeisdaddyherehomehellcomehomelaterpigpigyyywhatisthepigsayoinkoinkoinkoinkiseethreecowsonetwothreethatisalittlelambmaryhadalittlelambwhatuhohwhathappeneduhohohwhatisthematterupwellletstryagainwecantryagaintryitagainagainthereisthelambwhathappenedohwhatisthematterahhoneywhatisthematteryouhaveaproblemupupchairtumblehorseillhelpokaymommyllhelpyouhelpovertherethereitisbackbackdownisthatthelambnowhatisthatthereisthelambmaryhadalittlelambthereuhohwhatisthatthatisacowisthatabigcowthereallisonisthisabigcowwhatisitsmallsmallisthisasmallcowwhatisthatwhatisitisitsmallwhatisitwhereisthebabythereontelevisionthereisthebabyyesyesbabyallisonohiseeatruckthereisthebabytruckwhatdoyouwantbabytherewhatdoyouwanthertodoyouwanthertosityouwanthertositwhatcanmommyhelpokaywellhavebabysitinthetrucktruckuhohshekeepsfallinghoneytherebrrmuhohidontthinksowhatareyoudoingtruckbabyisinthetruckwhichbabyisinthetruckbabyyeswaitdontfallpleaseoutverygoodmicrophonemorerightmanrightthemanfixedthemicrophonedidntheuhohdoyouthinkthehorsewouldliketogoonthetruckthereisthehorsetumbleduckovertherecarefuldonttumblewhoaidontthinkthatissuchagoodideatumbledoyouthinkthereisanotherbabyinyourbagallisondoyouthinkthereisanotherbabyinyourbaggogetthebagtheretruckthereisthebabytumbletumblewhereisthetruckgoingtogowherewillthetruckgowherepoppoptoseepoppopnowherewillthetruckgobrrmbrrmisthatwhatyouresayingbrrmbrrmletsputsomethinginthetruckmaybetheduckwouldliketorideinthetruckdoyouthinksoletsputtheduckinthetruckshallwewethereistheduckokayheregoesbackbackisitgoingbackwardsbackoffontheremaybesomebodyelsewouldliketoridethetruckhowaboutthepigwhereisthepigbigbigrightthatisthebigchairtheredownchairbabydownareyousittingdownwhatdarlingwhereisdaddyhesattheofficeisheonthechairthatissillyisdaddyonthechairnobabyisonthechairsitdowntheremicrophonewhatdarlingyouwannagetdowndownisthisabigchairwhatisthissmallthatisbigyesdowndoyouknowwhatelseithinkisinthebagithinkwehavesomejuiceandsomecookiesinthebagbringthebagoverhoneybringthewholebagohverygoodletsseewhatisinitcookieithinksoohxxxlookatthatshallwehaveasnackletssitdownandhaveasnackonthechairokayokaywhatisthatcookiewhatiswrongwiththatonemoretherewhatshallidowiththiswhatisthatohithinkwehaveenoughohthankyouthankyoujuiceshallwehavesomejuiceinthecupmommyjuicebabyjuiceistherejuiceinthatcupnouhhuhjuicewhathappenedtothejuicegoneletmeseeisthereanyjuiceintheglassnoisitgoneohdontbreakupthecupwewontbeabletohavemorejuicejuicehowaboutyourcookiebackisthatgoodwanttogetdownwhathappenedwhathappenedwhatwasthatwhatdidihearburpmoreohsmallcanitieyourshoepleasebowwowwhosaysbowwowwhosaysbowwowwhowhereisthebowwowbowwowishomeyeahthebowwowishomewedidntbringthethebowwowwhereisthebabybowwowwhosaysbowwowdoesthebabysaybowwownodoesthecatsaybowwowwhosaysbowwowdoesthebabysaybowwowdoesthedogsaybowwowdoesthedogsaybowwowlaughsyoudontwantthatcookiedownwhatisthematteryouwanttoseewhatelseisinthebagyouwanttoseewhatelseisinthebagyesthereismommyontelevisionshallweseewhatelseisinourbagyesthereismommybabyyesmicrophoneohwhoiscryingbabyiscryingshallweseewhatelseisinourbagnoyoudontwanttoseewhatelseisinherelookwhatihaveyeahoffblanketoffokaywelltaketheblanketoffthereturnaroundahwhereisthebabytheresheisdoyouseeherherallisonsheisnexttothehorseonthefloordontyouseehersheisrightherenudieissheanudiebabyblankethereitiscoveryousleepygirlohyoureasleepygirlblanketcoverheadcoverherheadnudiehandlookwellcoverthebabywhoiscryingihearawhimperisthebabywhimperingokaysheisallcoveredyouknowmaybethebabyisdirtydoyouthinkthebabyisdirtythinksheisdirtyallisonithinkthebabyisdirtydirtyyeahithinksheisdirtydirtyyeahsheisverydirtyithinkweoughttogiveherabathhomewhenwegethomewellletspretendwellgiveherabathnowokayshallwegiveherabathwhatbathokayletsputherinthetubthereisatubohletsputherinhereputherininthecupletspretendthereiswaterinthecupoopwellgiveherabaththatisrightokayletssplashcanyousplashcanyousplashsplashsplashsplashsplashsplashbabybathdirtyweneedsomesoapbathhomeokaythatisalltakeheroutohcleanyesletswrapherupquickokaywhatshallwedohmmhandshallwedryerhandokaydryerhandmorebathscrubscrubbabyscrubscruboutokayithinksheisallcleannowletsdryheroffdryhertowelokaydrydrydrydrydoyouthinkshedliketogoforarideinthetrucknowthatwhatdoyousayshellgorideinthetruckwhereisthetruckthereohyousleepygirlbopwhoisbobhomeohwhatwhotumbledokayhereisthelittlebabybrrmwheredoyouthinkshellgointhetruckwillshegotothestoretherecookiewhatwhatwhatmicrophonemanputthatmicrophoneonrightwhatmouthwhatdidyouseewhatdidyouseeoverthereyeahandwhoelsebabydollbabyallisonyeswhatisallisondoingwhatareyoudoingplayidontseeyouplayingidontseeyouplayingohtalkyesyesareyoureadytotakeyourcoatoffnoletsunzipperititisverywarmohwellletstakeitoffletstakeyourcoatoffwhatneckwhatdoyouwantwhatwhatisonyourneckzipperupzipuparentyoualittlebitwarmarentyoualittlebitwarmbesidesitisnotrainingitisntrainingchildrenrainwalkrainyeswesawthechildrenwalkingintheraindidntwewhatwhowasinthecarmommywhatwhatwasmommydoingandwhatwerethechildrendoingtheywerewalkingintherainwhatwalktoschoolyesithinktheymighthavebeenwalkingtoschoolwhereisschoolwhoisatschoolwhereismommyyeahwhoelseisatschoolhmmwhocametoschoolwithmommymommytodayicanthearyouwhatisyournameyyyallisonallisonbloomwouldyouliketoplaywithsometoysnowhatwouldyouliketodohmmletsseewhattoysihaveletsseewhattoysihavebagoftoysyeahihaveabagletsseewhatisheretumbledonttumbletheremommyfloorsitdowndiaperbabydollbabydiapercleandiaperbabybabymommyhelpdiaperdiaperonwhatshallwedowiththediaperonwhatputthediaperonthebabydollohwellithinkthatdiaperdoesthatdiaperfitdoesthatdiaperfitisitadirtydiapermmidontthinksowhatdirtydirtydiaperawayiseedirtydiaperawayyeswethrowthedirtydiapersawayithinkthisdiaperisisthisasmalldiaperwhatisititiscleananditisithinktoobigforthisdollithinkitistoobigforthedollithinkthisisthediaperforsomebodyelseforallisonallisonbloommmhmmputthediaperonthebabyonthebabydollisthisthebabydollwhatisthisallisonthisisababydollokaymaybewecanputthediaperonthiswayhowisthathowisthatwellwecantholditonlikethatwhatdoweneedhmmwhatdoweneedforthediaperpinwherearethepinsohwedonthaveanypinsbuystorebuypinsatthestoreokaymaybewewillbuypinsatthestorebabydollsharphandswhatissharpohapinissharpisntitohtheresheisbabyliedownohyoutireddiaperimnotgoingtochangeyourdiaperontelevisiondiaperonyouvegotanicedrydiaperonithinkyourealrightwellchangeitlaterithinkitistimeforasnacknowwouldyoulikeasnackokayletstakeyourcoatofffirstletstakeyourcoatoffnowedonteatwithacoatondoweyouhavetotakeyourcoatoffnononotforasnackletstakeyourcoatoffyoucandoitallbyyourselfcanyoupullthezipperdownyougonnapullitupthatisthemicrophonemommyhasamicrophonemommyhasamicrophoneonshallwehaveoursnackwehavehaveapplejuiceandcoconutcookieszipperupithinkzipperdownithinkwelltakethecoatoffforthesnackyesyoucandoitallbyyourselfillgogetthejuiceforthesnackwhathoneyshallwetakeyourcoatoffandwellhaveasnackohyesyouknowwedonteatwithourcoatonohglassyesihaveaglassihaveaglassforthebabyyesmommysglassmommywillhaveaglassallisonwhatallisonwillhaveaglassalsookayletstakethezipperdownyoutakethecoatoffallbyyourselfohithoughtyouwantedtohaveasnacknookaywellhaveasnacklaterletsplaywithsomeothertoyshmmsnackwellletstakeyourcoatofffirstletstakeyourcoatofffirstmommyllletyouhavejuicebutyouhavetotakeyourcoatoffwedonthaveasnackwithourcoatsonnookaywelltakethezipperoffandyoutakeyourcoatoffallbywellletshaveasnackandthenwellputthecoatbackonokayletstakeyourcoatofffirsthaveasnackyescomeonmommywantssomejuiceandmommywantsacookieallisonletstakethecoatofffirstthatistherulethatistherulebigchaircoatonchairohgoodgirlgoodgirlokaywouldyoulikeacookiewhatwouldyoulikejuicehereyouholdthiscupwanttositdownohmygoodnessgodblessyoubabycupmommywhatbabydollbabydollcookiemmmmmmisthatgoodwhatdidyoudowhereisthecookieinthecupisthatayummycookiemommyllhaveapiecealsommmorejuicewhatwhatwhatmommyjuiceohyouwanttopouritbackbabyjuiceokayallisonneedssomejuiceuhohwhatdidmommydomommyspilledoolalaallisonspillingwhatdidyoudowhatdidyoudomessyesletswipeitupmoreyeahherehowboutdrinkingthejuiceagainwhatisagainohhoneydontspillitonpurposethatisnotsofunnythatisntfunnythatisnotfunnyyouresillyohletsputitawaymaybeyoudontwantanymorewellputitawayandhavesomelaterohthatisenoughyouresillyyoureasillygirlyoureasillygirlwellhavesomelateridontthinkyoureallywantitimgonnabringthetoysovercupwouldyoulikealittlemorejuicewouldyoulikealittlemorejuiceokayyoutakethetruckandillbringyoualittlemorejuicetakethetruckbacktothechairweetheresheisthereisthebabydollrunningbabydolltruckuptownbyewhoisgoinguptowntumblewhoisgoinguptownbabydollnapkinonohitisdirtywhatareyoudoingohscrubohyourescrubbingthebagscrubbingthetableandthechairyoureabighelpyoureprettygoodtohavearoundbabydollcleanwhatareyoudoingcleanwhathoneyskiprugtriprugithinksomethingelsewouldliketoridethetruckseeifyoucanfindsomethingintheboxwhydontyouseewhatisintheboxhihellomommypuppetpuppethitheyredeliciousfingersyummywhatisyummymommywhatwhatshouldidobabypuppettakethatpuppetyummyfingersmmmmyummymommypuppetwantmetoplaywiththispuppetdoyouknowwhatkindofpuppetthatislookatthosefloppyearsfloppywhatisthatlaughsyournoseyourhairyouresillymorewhatmorewhatmorepuppethairbathtubwhatisinthebathtubpuppetinthebathtubidontseeabathtubwhereisabathtubhomehomewhatdowedointhebathtubwetakeabathmommyshowermommytakesashowernudieyeswithahatonyesshallweseewhatelseisintheboxohliedownseewhatelseisintheboxwhydontyouseewhatelseisintheboxareyoushythatismryamandhehesmovingthemicrophoneareyoushyallofasuddenhmmseewhatelseisintheboxwellyoucanseewhatelseisinyourbagseewhatelseisinallisonsbaghmmnoareyoutiredwhatpuppetawayahyoutiredwouldyouliketoseewhatelseisisinyourbagnoboxcowdoyouthinkthereisanothercowinthatboxlambbahbahblacksheephaveyouanyyessiryessirwhatdoesthatlambdobahbackbahbackseewhatelseisinthatbagboxohallisonisthisabigcowwhatisitmommyhelphorseohweeweemanpolicewhatisthepolicemandorideoutwhatsweetheartyouresoshywhatisthepolicemandorideahorseyeahweehorsehorseweeboomuhohwhathappenedwhathappenedyouresillytodayithinkweregonnapackupandgohomewhatdoyousaymorewhatmicrophonemommymicrophoneonyestouchyoucantouchitpatpattingmommyshallwepackupandgohomewhatdoyousaymorewhatmorewhatsweetheartcomingwhatdidyoudoithinkthatisenoughithinkwellgetreadytogohomeshallweputourcoatonputyourcoatonmorewhatmorewhatmoretruckbabydollnapisshetakinganapohthenapkinohyourewipinghermommyyouwipingtherenowsheisallcleanwellwhatareyougoingtodoidontthinkyouhaveadirtydiaperithinkyouhaveacleandiaperwellleaveitonokaywipingwipingwhatheretheresheisallcleanlaughsyoureasillygirlwhatareyoudoingwhatareyoudoingwhatyouresosillydoyouseebabyallisonontelevisionrightyeahthereisallisoncombhairbabyallisoncombhairwhocombedyourhairmommyyeahwhatdidmommyputinyourhairbarretteisitdirtywipingbabyallisonchairmmmwhatwerewegonnadoshallweeatcookiesshallwemhmthatisagoodideawherearethecookiesinthebagokaybabyeatcookiesokayokaymommyllgetthebagandwellhavealittlesnackokayletshavealittlesnackeatcookiescomewellhavealittlelittlesnackwanttositdownokaydiaperoutnapkinouttherecookieyesyoucanhavesomecookieswhatmommyopenboxokaytheremmmmgetoutchocolatechipcookieithinkthatisjustachocolatecookiegetmommycookieohthankyoummtakesabitemommywhatmommyblouseonyeahmommyeatcookieeatapplejuiceokayletsseeohlookwhatihaveapplejuiceeatmommyscookieareyoueatingmommyscookieohfunnyallisonscookiemmeatingmommyscookiethankyoudarlingmmletshavesomejuiceopencanisthatagreencuporayellowcupitisayellowcupthankyoummimthirstystucktryagainlaughswhathappenedtothecookieyouvegotcrumbsonyourlapwhatareyoudoingwipingbabychinhowboutwipingyourchinwithyournapkinshallwehavesomejuicewhatareyoudoingshakingokayletshavesomejuiceohwelldonteatokayletsputthecookieonyourpamperhowisthatjuicewhatshallidowiththejuicenoeatwhatnothefloorisdirtysweetheartyoucaneatyourcookiehereisthecookiehereillpoursomejuiceforyoutherepourmommyjuicemorejuiceohdumpbabydiaperohmaybethatisenoughsweetheartmaybethatisenoughcookiesmaybethatisenoughcookiesohwhatdididoispilleditispilledityeahohareyougonnaeatallthosecookiestheyretoomanycookiesforyoutoeatithinkwellputsomeofthembackintheboxokayidontthinkweneedallthosecookieswillyouhelpmeputthembackinwhatisintheboxcrumbaretherecookiesintheboxaretherecookiesintheboxohthatisalotofcookiesletshavealittlemorejuiceandwellputthecookiesawaywehavetoystoplaywithwhatareyoulookingforareyoushyhuhareyoushywhatareyoudoingpeekingmommyyoupeekingatmommyiseeyouwhereisyourglasswhereisyourcupmmwhathappenedtoyourcupgoneohiseeititisbehindyouitisbehindyouwhatdidmommydomommyspilledtheapplejuiceagainohimadeamesswhatisthatyoufoundthecupyoufoundthecupeatingcrumbyouvegotaverydirtyhandletshavealittlemoreapplejuiceandwellplaywithsomealittlemoreapplejuicethankyouletsnotspillitokayletsputthecookiesawayandwhereisyourbabydollwellsweetieithinkyouvehadenoughcookieswellshallweleavethemonyourpamperrighthereandifyouwantokayletsleavethemrightthereandletsfindyourdollyourputawayallisonbagihaveallisonsbagisrightthereonthefloorlookwhatifoundbabydollgettoysokaywhatisthatonthefloorwhatdidiputdownthereyeahthereisatrucktoplaywithwehavemoretoysisthatacowhorsewhatgiddyuphorsegiddyuphorsewhatisababydollridetruckokaymommyhelpwhatshouldidohelpbabydollacowmoocowsaysmoobigcowsaysmoorightwhatwhereisthetinycowrightthatisthetinycowthankyouoinkoinknooinkitdidntmakeanoisewhenyousqueezeditdiditwellitdoesntsweetiethatpigdoesntsayoinkoinkwanttoputitawaywellputtheseinyourbagohshallwekeepthemdownhereithoughtthebabydollwasgonnaridethetrucknosheisnotgonnaridethetruckbabydollridetruckagainokaytheresheisokaywhereisshegonnagoschoolokayletsseehergotoschoolwhatsweetietruckoutsideschoolhmmfunnythatisfunnywhatallisonwhatwhatareyoudoingchewingareyoupeekingattheladypeekingladyareyouteasingiseeyouyourepeekinglookwhatelsemommyfoundcowwellnowlookwhatwehavecowhorsetumbleyesthehorsefelldownthereheisstandingupyeshesstandingupdoesahorsesaymoohesaysgiddyupcowsaysmooisthisthebigcowtinyisthisabigcowdaddycowwellyouknowwhatithinkithinkthisbigcowthisbigcowisreallyabullthisisreallycalledabullhesgonnaridethetruckokaythereheiswhatjumphesgonnaridethetruckandwhatisthiscowgonnadowaitwhatididnthearyousweetheartwhatdidyousaycaryyyyyyandthisbullisridingthetrucktherehegoeshesgonnagounderthetableunderthetableunderthetableherehecomesouttablemommywhatmommywhatshouldmommydopullcowintableokaythereitcomesilltakethesecookiesoutofthewayletsputthemoverhereherecomesthetruckherecomesherecomesohandhereisanothercowwhatishedoingwaitcowtruckwhatdidyousayithinkyouvehadenoughcookiesithinkyouvehadenoughcookiesmommyslapwhatdoyouwanttodositdowneatmommyscookiesitdowneatmommyscookieisthatwhatyouwanttodowhatisthereamandrivingthetruckisthereidontseeamandrivingthetruckyoudoareyoupretendingstepinbabydrivetruckcanyoudriveatruckohprettygoodbabyridetruckmmbabyridetruckokayyouridethetruckwhereareyougoingohyouregoingtoschoolokayletsgobrrmithinkthepigwantstoridethetruckokayitisthepigsturnhesgonnaridethetruckandhowboutthebabydollwhatwillshedowaittruckbangbabybackohitissharpohiseeyesitissharpbabyridetruckcanyouridethattruckitissharpsoyouhavetobecarefulwhatisonyourbackohitissharpwhatwhatisthatwhatisthatthatisthepigsohhehurthiskneehurttruckdidhehurthiskneeordidhehurtthebebecarefulitissharpyespleasebecarefulmoreapplejuicewellhoneythatisadirtycookiethatwasonthefloorletsputthatdownletsputthatdownbecauseitisadirtyonetakeacleanoneoffofthepamperthereokayshouldwehavemoreapplejuiceokayshouldwewillyouhelpmeputthetoysawaynoithinkweoughttoputthetoysawayfirstnowhatmommyeatcookiemmgoodwhatareyoudoingwhatareyoudoingohcarefulbecarefulbuildtoweryougonnabuildatowerohthatisanicetoweristhatabigbigtowerohyouwanttoknockwhattumblewellsweetieifyouknockthistoweroverhoneyyoullspillwillyouhelpmeputthetoysawaysitdownrighttherenexttruckdrinkapplejuiceschoolyoudrinkingapplejuiceinschoolisthatwhatyouredoinghiwhatareyoudoingwhatareyoudoingsqueezingwhatareyousqueezingyouresqueezingthecupyouresillyyoureasillygirlwouldyouliketowashwipeyourhandsandfacenoshallmommydoitwhatareyoudoingtodowiththatcupnowsqueezeagainmommycombhairitlooksfinesweetheartyourhairlookslovelymommybrushedyourhairbeforewelefthomeallisoninwhatintelevisionallisonintelevisionwhatareyouwearingwhichdressisthatponydresscanyoushowthatladytheponyonyourdresscanyoushowhertheponyonyourdressohareyoushyareyoushyhuhokayithinkwellputthetoysawayandgetreadytogohomewhatdoyousaycabnohowwegonnagohomecarwehaveourcaroutsidedontwewehaveourcaroutsideokaywillyouhelpmeputthetoysawayputwhatawayhomewehavetoputthetoysawayfirstcomehelpmeletsgogoquicklydrinkapplejuiceaokayokaytherebabycupokaythereisalittlebitmoresqueezingcupthatisfunnythatisveryfunnywhatscreamingscreamingwhatareyoulookingatohareyoushyyoureashygirlyoureashyflowerwhatareyoudoingtherewellheturneditoffwelllookatitlaterheturnedthepictureofallisonoffwelllookatitinalittlewhileokaywhatwouldyouliketodoyouwanttoeatyoursnackokaywhereiswhatyouwanttotrythisnecklaceokayseeitisamicrophonethereyoudontwantithowaboutasnackhowaboutasnackyouwannasitonhereokaywhatdowehaveforthesnackwhatwhatwouldyouliketohaveapplejuicealrightohwhatdidisayaboutthatwhatdidisayaboutdrinkingitoutofthecanyouwantitawwellthatisnotsuchagoodideahoneyyouknowwhythatisnotagoodidealetmetryitfirstofallithinkthereissandonitihavetoseeithinkitisbettertodrinkitoutofacupithinksoyehithinksoyoutakeacupyouwantapinkcupwhaticanthearyouwhatyouwantsomeapplejuiceyouwantmorejuicewithcookiesblessyouwhatisthathoneyicanthearyouyouwantsomecookiesputthesehereyouthatdownhmmchocolatechipcookiesomechocolatechipcookieohwhathappenedwhatdidyoudowhatdidyoudowhatdidyoudowhatitcameonyourdressitdidntcameonthecookieohmeanswebetterwipeyouoffhereisatissuewipeyourselfoffcauseyouredirtyyehletmehelpyouwiththatwhatdarlingokaynowdrinkthatcarefullyhowaboutmedoiwantsomecookiesyehmaybeillhaveacookiewhatsweetheartyehitdidbutdidyouwhatisthatrightimsorryyoureamessanotherpuddleokayletsfinishupthatjuiceandthatwillbethatwillbetheendxxxswallowwhatisinyourmouthfirstokayyouwantwhatwhatisrealcloseyouwantthetablerealcloseokayyouwontbeabletogetdowncauseyouregoingtoplayonthefloorinalittlewhilesohurryupandfinishyoursnackandwecanplaywithsometoyspushthetablebackohnoidontthinkillhaveasnackidratherplaywithsometoysrightnowcomesitoverheresweetheartthisisadumptruckyehyouwantcookiesinitwhatdarlingcanieatonehmmhmmwherereyougoingwiththosecookiesyouregonnadumpthemoutwellifyoudumpthemonthefloortheywontbetoocleantoeatmaybewebetterputthembackintothebagicanthearyouwhatareyoudoingelevatorletmeseeanelevatoryoureafunnygirlwhatareyoudoingsorryimverycomfortablehereuhuhyousillygirlyousillygirlheyiseesomebodywhowouldliketoridethetruckwhoisintherewhoisthatwhoisthatthatisclementineohshefelloutwhatwanttomakeherwhatshecouldfitinokayyoudoingwhydontyoutakeherforatripwheredoyouthinkshedliketogoonthattruckhmmontheelevatorokayyougouptheelevatorokaythengoallthewaydownfirstthenyousayitupupupupuptothetopoftheelevatoryouthinkshelikesthataskheraskherifshelikethatoutoftheboxyoupickingupwhatissheissayingahwouldyouliketoaskheraskherwhereshedliketogothatisagoodideaaskheraskherithinktheairportisoverthereokaytoomuchtrafficattheairportyouhavetocarryhertooheavynowwhereisshegoingohhoareyoumarchingagainmaybeshedliketomarchseeifshedliketomarchihavetotakethetruckwithmeandmarchletmeseeyoudothatwhatareyoudoingokayokayillmarchtooohivegotthemicrophoneonicantmovetoofarithinktherearemoretoysinthatboxovertheregoseewhatisinthatboxicanthearyouyourewhisperingrightwhatareyoudoingyourejumpingupanddownidliketoseewhatisinthatboxwouldyougogetthatboxformeohyesyouwanttoputclementineinisthatwhatxxxsayingwanttoputyourfriendsinhereagainheyheywhatareyoudoingwhoaheydoyouthinkthattheanimalswouldliketositonachairorthetablewhatdoyouthinktheywouldliketodookayletsbringtheanimalsoverheresweetheartillpourthejuiceandyoubringtheanimalsoverhereanimalsyouliketohavesomesnackandjuiceyouwantsomeletsputthemoverhereletsturnthisaroundsoyoucandoitxxxputthatmicrophonetherewhataretheydoingtheyredrinkingaskthemiftheylikeiticanthearyouyourewhisperinginfrontofthesheepnoroomletsmakesomeroomtheretheyrealldrinkinghmmthinktheylikeitaskthemiftheylikeitokayyougolookinthatboxwhathoneynothingwhatnothingisleftinthereohwhathappenedyoubrokehimyouwanttoputhimtogetheragainokaywhatdarlingdoyourememberwhatthatisyoudontwanttowearitwhereisthecanjustthatcookieokaywellputtheothersawayyoucanfinishthisonefinishthiscookiewhatyouwantthisothercookieforthemallisonthatisapigthatisapigisthatapigthankyouokayisthisyourcookieohisitgoodhmmisthiswhatiswhatwhereisthedaddycowwhataretheyagaintellmeagainwhatisthisandsmallcowandwhereisthesmallcowandwhereisthebigcowandwhereisthebiggercowrightthereandwhereisthesmallercowandwhereisthebiggestcowisthisaxxxsheepawhatacowthatisacowapigherewebetterputtheanimalsawaynowiththemletmeseewanttorunaroundwithusuhyourehelpinghimgorunningaroundwithyouhowaboutputtinghimonthefloorandmakeaparadeshallwehaveaparadeonthefloorokayokaytheywannawalkinparadeheysomebodyismissingwherearetheymarchingtoahomeallgonnamarchtogetheryouregrowingbiggeryourenoticingyourebiggergirlhowdoyouknowthatyouregrowingbiggerhowhowdoyouknowyouregrowingbiggerohyouretwoyearsoldiseeithinkmaybeitistimetoputtheanimalsawaynowhyyouvebeenmarchingforawhileithinkweoughttodosomethingelseexerciseslikewhatahhahithinkitistimeweputtheanimalsawaywhydontyougettheboxandwellputthemtosleepalrightnowhatwouldyouliketodowiththemithinktheyretiredofmarchingithinktheydlikearestnowhatwasthatwhatdarlingicanthearyouallgonnadrinkourjuicewhatdidyoudowhosejuiceisthatitisallisonsthoughtyoudgivethatjuicetotheanimalsnoiseeokayyoucandrinkitahyouspilleditanimalsdidntwantthatnowhywhydidnttheywantthatokaywhydidtheanimalsnotwantitthisismycupyumisitdelicioustheylikeityouwantonecookiewellyouvehadafewcookiessweetheartwehavetostartputtingthetoysawayitistimeforthemtoresttheybeenverybusynothankyouitwasonthefloorixxxofititwasontheflooryoucanhavemorecookieswhenyougethomeletsputthatoneupheretooiknowyoudrathereatitillgiveyouanothercookiewhenwhenwegohomealrightithinkitistimetoputtheanimalsbackintotheboxpleasehelpmeshallidoitallaloneicanthearyouhoneyisitgonnacomeonnowiswhatgonnacomeonnowyouyesyouwecouldplaywithsometoysnowifyoudlikewhenwhatcomesonohwellitisalreadyondoyouseethetapemovingovertheresowecanplaynowandhaveasnackordoanythingyouwantnownotnowmaybelatermaybenowidkindoflikeasnackicanthearyouokaywellillgetitokaysowellbereadyshouldisitonthebenchiwanttotakethesethingsoutwannahelpicanthearyouhoneycanyoutalklouderthatisenoughthatisenoughhoneythatisallwellusewellwrapupthepackageandputthembackwhydontyouputthecookiesonthisnapkinheresitupherewithxxxwhatwantsomejuiceokayuhohwellwedonthavestrawsokayhmmisitgoodiwishihadsomejuicecanyoutalklouderhoneyokaythankyouwellheyheywhathappenedhibutlookwhatyoudidwhatdidyoudohereyoumadeapuddleisrighticanthearyouwhathoneywhataboutthosebarsyoucantwhyhmmthatchairisinbadshapeisntitseemstobebrokenyouthinkyoubrokeitwhydoithinkyoubrokeitidontthinksowhydoyouthinkyoubrokeiticanthearyouhoneyidontthinkyoubrokeitithinkitwasbrokenbeforeidontknowitisjustanoldbenchitisbeenhereforalongtimehmmhmmcanimovethebenchokaypushyouclosethereyouneedanothernapkintowipethatpuddleupwhatareyoudoingwhatshallidowithityesthereisnojuiceintherelaughsistherejuiceinthereyousaidtherewasnojuiceintherethereisnoidontthinksonohoneyithinknotthisismyjuicehoneyidontthinkitisgoingtogointhatlittleholeithinkiddrinkthatjuiceithinkyououghtadrinkthatjuiceyoudontwantitwellthenjustleaveitletsnotpouritbackinthecanheyyouregoingtospillitalloversillygirlithinkillputthecanawayahcomeonnowheyitisyourcannowlistenlistentowhatimgoingtotellyoulistentowhatimgoingtotellyouifyoutrytopourthejuiceinhereitisgoingtospillalloverandthatwouldmakequiteaokaysowerenotgonnadothatrightnowalrightyoucanplaywithsometoysifyourereadyokayletsbringthemoverherewhatwasthatyoulostyourotherpigsowhatwouldyouliketodowellhoneythatdoesntbelongtouswhatwecantitdoesntbelongtousiknowiknowwelostourotherpigbutthatisnotourshoneywhybecauseitbelongstototheschoolwecanplaywithitbutwecanttakeithomewhatdoesthepigsayitdoesntsaynothingyouresqueezingitnoitdoesntmakeanynoisewhydoesitmakenothingbecauseitdoesnthaveawhistleinityouseethereisnoholewithalittlewhistlethesejustdontmakeanynoiseisthataschoolbusitisnotaregularbusitisaschoolbushmmhereisaboardahithinkthatiswheretheyputtheydontseemtohaveanyisthataseaplanewhathoneywhereisthepignowwhathappenedidontthinksoyesicanthearwhatyouresayingyoucantputitonwheredothepassengersgowellidontknowwheredoyouthinkthepassengersgoyehwelltherearenoseatstherebutithinkthatiswheretheydotheydogointherebuttherearenoseatsthisbusdoesnthaveseatsihaveapassengerforthatbussoclementinedoesntgoinhereshedoesntfitwellwhydontyoustopyoushouldaskherifsheisliketotakearideonthatbusohyoufoundaplaceforthepassengersicanthearyoucaniholdherwhileipushthebuswellletsseewhichwaydoyouwanthertoridelikecuriousgeorgedoesajoblikethisokayimnotsurewhereisshegoingreachoverheyyouwantmetopushhermaybeshedoesntwanttogowhydontyouaskherifshewantstogoyouaskhernoyouaskheryouyouyouokayillaskherclementinedoyouwanttogoforarideshesaidyesletsgetheronherewhatisthematteryouhavetogotothetoiletcanweokaywellberightbackicanthearyouyoucantalkveryloudlyhereifyouwantyouknowthatjustlikeyouwereshoutinginthehallsyoucanshouthereifyouwantwhatohyoufounditthatisyouwiththeflowerdressonicanseeitdarlingicanseeitallisoncomeheresweetheartihaveapantsuitoncomeoncomeherecomehereletsplayoverhereyoujustwantedtolookatitiknowididseecomeclosetoyoucomeclosetothetelevisionaminutewellilltellyouwhatwhenwereallfinishedwellgolookatthattelevisionsetokaywehavetoystoplaywithnowokayehthiswillcarryittheairplaneokaywhatthistruckcarryidontknowwhatdoyouthinkitcarriesletsturnitthiswaytryitthiswayturnitthiswayohdeardoesntwhatdoesntfithmmhmmwellilltryokayidontknowwellitiskindofhardtodohoneyhmmwellyouredoingverywellwhereisthetruckwhatisthetruckdoingohhowhatwhatcomeherewhoisshesheismecomeheresheisallisonyeseasyheyheycarefulifoundsomethingthatwillrideinthebusnonotthatitwonthowboutthatgiraffeitwasstuckhowaboutthegiraffewhatdidyoudothrowittomeuhwhatitwentrightintoyourjuiceithinkyouregettingalittlesillycomehereletsputtheheadbackonthegiraffeallisoncomeherenocomeondontbesillyillthrowthejuiceawayithinkyourefinishedareyoufinishedwithyourcookietoonowhatyoudowantitwhatareyougoingtodowithiticanthearyouyourewhisperingwhatareyougoingtodowithitokayillputitrightthereiyouwantitwhatokayuntieitletsseeificanuntieitcanyouuntieitnowhatyoucantnowletsseethereokaywhatshallidotherewheredshegetthatponchowheredidclementinegetthisponchoohdoyouthinkshemadeitforherthatisveryniceitisredandwhiteokaywhatisitwhatdoesitlooklikenotfromanicecreamstickohfromanicecreamsandwichohlooklookwhoisherewanttoseewhoisatthatdoorillgoopenthedoorhihixxxhewonttakeyourtoysawaywhydontyoushowhimsomeofyourtoysyoushowhimyoushowhimmaybehedliketoseethetruckokayyesithinkhelikesthetruckhestouchingitwithhisfingerrightyouregettingthethingstogethersohewonttakethethingswellmaybehedliketohaveacookiethoseareallbitedrightwhydontyouaskhisdaddyifhecanhaveoneyouaskhimcanhehaveacookiesurewanttogiveittohimsweetheartokaysweethearttheyreinthebagwellyouhavetobenddownthatisagoodideamaybehellwantitlaterrightonthenapkinwiththeothersokayputthecookiesbackinthebagwhyidontthinkillthrowthemtoomuchillputthegiraffebacktogetherdontthereifyouscrewitoutwhathappenswhatareyoudoingwanttoshowittothatlittleboyhmmwanttoshowittothatlittleboythatisalittlebabyyesmaybeyoubettertellhimwhatitisyoutellhimidontknowwhatisisiforgotthatisagiraffewellyoutellhimhecanchewonitcausewhyhelikestochewonitiknowhelikesiticantellyoujustwantedtoyouresuchasillydoyouthinkweshouldpackupandgetreadytogohomenoletsstayherewhywhatshallwedowhatshallwedoithinkweoughttoputeverythingtogetherithinkweoughttoputthetoysawaynowwhatdoyousayletsstayhereitisgettingkindoflateitisreallytimetogocomeonyouhelpmeokaygetthecupsmaybethatlittlebabywouldlikeoneofthecupstoplaywiththinksonohewontdrinkallthejuiceupithinkthereissomeemptycupstheremaybehedlikeanemptycupwhatdoyousayimgoingtotryputtingthetoysawaypussycatcauseithinkitistimetogoyouknowyoudidntplaywiththeseatallyoudidntatallhmmwhatareyoudoingtodowiththemyouregonnaplaywiththemnowokayletsturnaroundhereandplaywiththemyehokayfinewhatreyougonnadowiththemillaskhisdaddywhatishimnamewhatishisnamemarklaughsweknowsomeonenamedmarkwhodoweknowwhosenameismarkyoudontknowdidyouforgetokayletsputalltheanimalsbackintheboxyouwanttostayherewevebeenhereaverylongtimewereaboutthroughandyouhaventplayedwiththefarmanimalswhereisitgoingohitisgoingtoschoolwiththepassengerwowokayiguessthiscowandthiscalfandthisbullgobackintothewhatdoyousayitisgoingtogobackintotheboxandthebullisgoingbackwellokayforafewminuteswelljustafewmoreminutessweetheartwereallyhavetostartgoinghome