-
## Expected Behavior
This is my input.csv file:
```
id,sequence
heterodimer_2,MAAEAWRSRFRERVVEAAERWESVGESLATALTHLKSPMHAGDEEEAAAARTRIQLAMGELVDASRNLASAMSLMKVAELLALHGGSVNPSTHLGEISLLGDQYLAERNAGIKLLEAG…
Nuta0 updated
1 month ago
-
**Description**
The user who creates a Kyma cluster in the BTP cockpit should be able to enforce the location of the Control Plane to be in the same region as the Hyperscaler account where the Wor…
-
### Prerequisite
- [X] I have searched [Issues](https://github.com/open-mmlab/mmcv/issues) and [Discussions](https://github.com/open-mmlab/mmcv/discussions) but cannot get the expected help.
- [X] Th…
-
I have converted editing_tryon_zeroshot.ipynb in LAVIS\projects\blip-diffusion\notebooks to tryon.py.
Below is the code content of tryon.py.I did not change the original .ipynb file by converting it …
-
### Is your feature request related to a problem? Please elaborate.
Not necessarily a qbitmanage problem, it runs as it should. However, in scenarios where external programs like cross-seed are addin…
-
Matthijs Welkers mentioned that he had tried to use Nextclade's primer feature with monkeypox (he has published an amplicon tiling scheme for nanopore) but that he got an error when he tried using his…
-
Hi,
I am running dowhy using the following:
```
causal_graph = """digraph {
}"""
#print(df_dowhy)
model = dowhy.CausalModel(data=df_dowhy,
graph=causal_graph.re…
-
I am unable to execute this command:
`qbt torrent category move --from freeleech --to completed --min-seed-time 10100`
the output is
```
Found 2 matching torrents to move from (freeleech) to (com…
-
I am searching for a new seed to use on my server because of "the update that changed the world". The World will get a border(Bukkit WorldBorder) if its online, so i wish that there are mostly all bas…
-
Good afternoon! I recently ran into an issue where there is pattern discrepancy between runs with sparseOptimization set to TRUE versus FALSE. The code I ran and the output is below. With sparseOptimi…