-
### What are you trying to do?
I want to start ollama serve in the background for automation purposes, and then be able to run something like `ollama ready` which would block until the serve has load…
-
I tried running this on a few computers. I got it working on my Mac after changing the MPS. I also created a collab to get this up and running. This doesn't seem viable for anything lower than a 4090.…
-
Hi atmoz
Saw your ycombinator post about this. I did a "go get" and got an exe. I'm on Windows7. Shall I give it a try?
-
I came across this great repo wanting to start writing X-Plane plugins in Rust instead of C++. I've read the readme, and the notes about drawing and display SDK parts needing 'some more work'. Is it r…
-
hello ! I've got a problem with ColabFold: AlphaFold2 using MMseqs2 , when I use the sequence of a-synuclein (MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSI…
-
I watched the Strange Loop talk and played around with the Outboard API over the weekend. I am very impressed with the work being done here. Being able to treat the database as a persistent data-struc…
-
**Very buggy, not sure if it's the server or the plugin**
_(trying to host it elsewhere as current server is running)_
> Fix some event issues, currently broken.
> Some bugs have already been f…
-
Hi
Is the library ready for use? We are extensively using formio and have not seen any updates on this library. Could someone from development team please confirm on that?
Thanks
-
### What problem are you facing?
Right now, it is possible to create ProviderConfigs as part of a Composition, but the composition never transitions to a Ready status. This appears to be because ev…
-