-
Check following papers:
- [ ] [AlphaFold2 can predict single-mutation effects](https://www.biorxiv.org/content/10.1101/2022.04.14.488301v5)
- [ ] [Using AlphaFold to predict the impact of single m…
-
I have a cyclic peptide sequence. I put it into Alphafold2 Colab, but I didn't get a cyclic peptide structure. What should I do to connect the C-terminal and N-terminal for the next dynamic simulation…
-
toolshed.g2.bx.psu.edu/repos/galaxy-australia/alphafold2/alphafold/2.1.2+galaxy0
Most current version installed at **UseGalaxy.org and UseGalaxy.eu**.
No version is installed at **UseGalaxy.org.au…
-
I installed localcolabfold and copied HighFold git repo into my localcolabfold.
So that my localcolabfold git repo looks as
:
I0605 11:20:06.397124 140157971002496 run_docker.py:…
-
**Is your feature request related to a problem? Please describe.**
Rust-bio contains the ability to provide easy %GC with a simple command but what about the other interesting parameters
**Descri…
-
hello ! I've got a problem with ColabFold: AlphaFold2 using MMseqs2 , when I use the sequence of a-synuclein (MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSI…
-
Hi,
First of all, I would like to thank the author for creating a great tool.
The problem I am having is very simple. Currently, DPAM uses json to read predicted aligned errors (for AF2 database a…
-
Hello,
we've been trying the updated AlphaFold2_mmseqs2 notebook hoping to be able to use AF-Multimer with a custom MSA. However setting msa_mode to custom seems to be reverting the pipeline to monom…