-
In #3210 and #2054 I have been working on a proposal to allow filling animations to not leak memory. I have [prepared spec text](https://github.com/w3c/csswg-drafts/compare/master...birtles:fill-anima…
-
Currently the code doesn't allow matrix specification for DNA searches. Would it be an easy feature to add?
-
Hello,
First off: great module! I just implemented it and it works like a charm with my own data.
Now I want to do some error analysis by printing out the top 100 scores of certain relationship typ…
Lirry updated
6 years ago
-
**Original report ([archived issue](https://DedalusProject.github.io/dedalus_bitbucket_history/#!/dedalus-project/dedalus/issues/38)) by Pierre Augier (Bitbucket: [paugier](https://bitbucket.org/%7Beb…
-
I was trying to tackle the problem of animation export (all animation, correct naming etc.) and I ran into a few problems, mainly to do with code duplication and comprehension.
Currently it looks l…
Usnul updated
5 years ago
-
### Summary
When running the first-level model estimation with the `multitaper_product` option to do pre-whitening, the workflow crashes.
### Actual behavior
That's the error message:
~~~.pyt…
-
## Expected Behavior
According to the documentation, when extracting the representative sequences either by manually performing these steps:
```
mmseqs result2repseq DB clu clu_rep
mmseqs resu…
-
I find it difficult to determine, for a failing `expect_equal` expectation, the actual value that has been computed. It would be great if, in this case, the expected and actual values would be printed…
-
Hi,
it would be nice to call det(A) on a matrix A with DynamicPolynomials as entries. Is this easily implementable?
-
## Expected Behavior
Some identical sequence must be clustered together.
For example in the pan.fasta file :
```
>GCF_001259475.1_4370_2_2_genomic_00977
MFSNLKHVVMLMLLASAASYALAAPAPVSDLGSNVSGGSR…