-
The following workflow produces unexpected results:
Start the test, play first sample, click somewhere and comment. Then click Next. It says *'You have not played track Fragment 1.'* which is good.…
-
Validate if
1. enzyme activity is described by the IUBMB EC classification system (http://www.chem.qmul.ac.uk/iubmb/)
2. a dbSNP RS identifier is correctly linked to a gene
3. substrates and produc…
cebel updated
7 years ago
-
From: s.e.grier@qmul.ac.uk
Bugzilla-Id: 2711
Version: 2.2.x
Owner: [Ken Murchison](murch@andrew.cmu.edu)
brong updated
7 years ago
-
Reproducable with:
String aa = "MSFSRLYRLLKPALLCGALAAPGLASTMCASRDDWRCARSMHEFSAKDIDGRMVNLDKYRGHVCIVTNVASQUGKTDVNYTQLVDLHARYAECGLRILAFPCNQFGRQEPGSNAEIKEFAAGYNVKFDLFSKICVNGDDAHPLWKWMKVQPKGRGMLGNAI…
-
On an up-to-date Debian Testing distribution, something is going wrong with loading the Digraphs package. Everything appears to be okay during the build, but when I open GAP and try to load Digraphs,…
-
Sometimes gluesemantics.doctest fails because of nondeterministic output. Here is an example of a successful run
```
[dimazest@mac nltk]$ tox -epy27 -- nltk.sem gluesemantics.doctest -v
GLOB sdist-ma…
-
Here is the location: http://machine-listening.eecs.qmul.ac.uk/bird-audio-detection-challenge/
-
I've checked this nomenclature with iupac recommendations.
Some chemical elements changed it's names.
[http://www.chem.qmul.ac.uk/iupac/AtWt/table.html]
**Correct this values please.**
Ununtri…
ashed updated
7 years ago
-
> Originally reported on W3C Bugzilla [ISSUE-19885](https://www.w3.org/Bugs/Public/show_bug.cgi?id=19885) Wed, 07 Nov 2012 00:51:17 GMT
> Reported by Ehsan Akhgari [:ehsan]
> Assigned to
Currently t…
-
Anil (@avsm) maintains a large set of OCaml Dockerfiles (https://github.com/ocaml/ocaml-dockerfiles) that may be useful for Dockerising this component. I think the `alpine` branch would work out well.