-
SWG Discussion on HPs:
To sort through the HP challenges for v0.7, we are looking at roughly these tasks:
1. Clearly list all HPs from v0.6 and their rules
2. Choose an alignment strategy (for co…
-
Hi, I was trying to run the following command `neuralplexer-inference --task=batched_structure_sampling --input-receptor DERETWSGKVDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYGIMLAVGGIPLFYMELALGQHNRKGAITCWGRLV…
-
This is a follow-up on https://github.com/PHPCompatibility/PHPCompatibility/pull/1586#discussion_r1273349132 so the task doesn't get lost / forgotten. We would like to have a sniff to enforce alignmen…
-
Just noticing a bug I think in segment.
Output files are being produced into the `AUDIO_PATH` folder . I was expecting the TextGrid file to be produce in the same directory where the progra…
-
When running the pipeline with a single sample you get the following error when running the Salmon step.
> Execution completed unsuccessfully!
>
> The exit status of the task that caused the wor…
-
Hi fmriprep experts,
I am using fmriprep 1.4.0 to preprocess our anatomical and functional data. I found something wrong with the brain tissue segmentation and the spatial normalization of the T1w.…
-
Issue Description:
I believe there is a crucial feature missing in the game that affects task management. During gameplay, each task should be evaluated to determine the minimum time required for ea…
-
* PIGT version:
* Python version: 3.10
* Operating System: Linux
### Description
I am trying to generate a protein-ligand complex for a small protein (536 residues) and got `torch.cuda.OutOfMe…
-
Hello Adrian,
Thanks for sharing your code in pytorch. I noticed that you have probably tested several models with less stacked FAN [here](https://github.com/1adrianb/face-alignment/blob/478c388237…
Yozey updated
3 years ago
-
Trailing White spaces show up on cheat sheet.