-
Our PWS states:
`Production operations within an Authority to Operate (ATO), which may be able to be inherited
from other systems, but also may require additional ATO activities. This will include…
-
**Is your feature request related to a problem? Please describe.**
Hello FastStream Team, first of all, thanks for your project and your work.
I am evaluating FastStream with PydanticV2 written in…
-
### Use case
One of the biggest pain points for package authors (and probably app developers too) that have been brought up during the Dart & Flutter Package Ecosystem Summits is that Flutter has p…
-
Explicitly show the results of the dependencies view
-
```shell
poetry add --group dev deptry
poetry run deptry .
```
-
I saw that there haven't been many updates over the past months. Is this repo still being maintained?
-
from https://github.com/GoogleChromeLabs/critters:
> [!CAUTION]
> Ownership of Critters has moved to the Nuxt team, who will be maintaining the project going forward. If you'd like to keep using …
-
Currently the Dependencies of a Dependency are automatically added to the app.json.
I understand that this make things more explicit, but we currently don't want this always.
e.g. we have a library …
-
from #401 @ludovicorighi
> Currently, we don't highlight scenarios in which job_A depends on job_B and job_B does not have any at least one enabled schedule. I would at least warn the user about th…
-
hello ! I've got a problem with ColabFold: AlphaFold2 using MMseqs2 , when I use the sequence of a-synuclein (MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSI…