-
I used orthogroups identified in OrthoFinder as input for HyPhy analyses. I am working with 27 species, and there are 2,592 orthogroups identified as single-copy in all species. To include more orthog…
-
Example script:
```
python scripts/benchmark_jailbreak_bench.py \
--model_name Qwen/Qwen2-0.5B-Instruct \
--intervention \
--intervention_layers 19 20 21 22 \
--max_tokens 512 …
-
User email on 20240730: Priority issue.
"I'm having issues with the blast function of peanutbase. Earlier I tried to blast a sequence and the website was "BLAST-ing" for about 30 minutes. It never…
-
#### Description:
We have identified the need to enhance our modal components, particularly the "Modal with Sequence" types. The task involves first validating the current modal implementations to en…
-
The following two lines yield an exception on Mac and Ubuntu 20.04 (jdk 1.8). Have had a similar issue when trying to use MidiSequence with Parts. Perhaps this is as simple as a missed "open" statem…
-
In the sidebar, add sequence number to the slides so you can know the order of that element in the presentation
-
Hi,
I just realized that cablastp-extract appends `*` characters to my protein sequnces:
Input
```
>tr|R4XQ05|R4XQ05_ALCXX
MTMDSTIYLTLWAVLAFVSWLIVAGGAVLAVFSRAIKDTTFERIGLAAVSLTATGAACRIFMAGWASAGDAALAA
…
-
I am writing a block that utilizes an external javascript library - progressbar.js
For this, I will need a script that I can load on the frontend that will execute the library upon each block. My pre…
-
**Note from the teaching team:** This bug was reported during the _Part II (Evaluating Documents)_ stage of the PE. **You may reject this bug if it is not related to the quality of documentation.**
Th…
-
**Note from the teaching team:** This bug was reported during the _Part II (Evaluating Documents)_ stage of the PE. **You may reject this bug if it is not related to the quality of documentation.**
Un…