-
Maintainer: @jslachta
Environment: OpenWRT 23.05.3 on Zyxel NBG6716 ath79 / mips_24kc
Description:
I Installed OpenWRT 23.05.3 with Asterisk 20 on a Zyxel NBG6716 Router with all my other re…
-
I'm loving the guide, I just saw this small error in section [3.3](https://www.greghendershott.com/fear-of-macros/Transform_.html#%28part._.Actually_transforming_the_input%29). At the top of the secti…
-
$ /mingw64/bin/emacs --version
```
GNU Emacs 28.2
Copyright (C) 2022 Free Software Foundation, Inc.
GNU Emacs comes with ABSOLUTELY NO WARRANTY.
You may redistribute copies of GNU Emacs
under th…
-
### Before You Begin
- [X] I confirm that I have downloaded the latest version of the addon.
- [X] I am not playing on a private server.
- [X] I checked for an [existing, open ticket](https://github.…
-
Hi,
I have a simple question regarding your driver: does it support data transfer through the ACP port?
I tried with a zynq ultrascale+ device and I get the following log:
[ 126.148496] xilinx…
-
I have an angular app which has two apps and one shell app.
Micro app : home and aboutus
Shell app : cz-app
In shell app I have one page (contactus) where I have a drop-down with two values (ho…
-
I have a tablet with a few buttons that send mouse signals to emacs, (mouse events 8-12). I can catch the event with an ordinary emacs global-set-key just fine, but I'd like to map them into the simul…
-
At the moment, we extract the most useful bits of data (filename, (un)compressed size, offset, CRC, etc) and populate the public array.
However, if we start to implement features such as #12, then …
-
The problem occurs when using IMGT numbering of the following sequence:
`EVQLVESGGGLVQPGGSLRLSCAASGIILDYYPIGWFRQAPGKEREGVAFITNSDDSTIYTNYADSVKGRFTISRDKNSLYLQMNSLRAEDTAVYYCSSKASFLIGKDDQGIDAGEYDYWGQGTMV…
-
```
It would load properly, and make an initial query of the status, but it failed
to update at the 'refresh' interval. To fix this I had to replace the
setTimeout refresh function to read:
setInte…