Open mmtohm opened 1 year ago
You will have to remove the * character at the end of the sequences
On Tue, Feb 28, 2023, 2:15 PM mmtohm @.***> wrote:
Hi, I ran this command "./run-GOMAP-SINGLE.sh --step=seqsim --config=test/config.yml" on PBS script and error file show this : "The input sequences contain non IUPAC amino acid characters"
How to fix it? This is my sequence
TRINITY_DN0_c0_g1_i101.p5 TRINITY_DN0_c0_g1~~TRINITY_DN0_c0_g1_i101.p5 ORF type:complete len:128 (+),score=3.74 TRINITY_DN0_c0_g1_i101:3043-3426(+)
MNQMHFFFSNRYGVTQIITISATHVLYRLFSPFPPSLHLECYSTTNHCRALQAQGNFLAQVNKKILSFFCCIKPHTPIHFCTYRLDFLGGKFNETANISDVSVEKCANGNSFLLFVWITVSLVLINL*
— Reply to this email directly, view it on GitHub https://github.com/Dill-PICL/GOMAP-singularity/issues/29, or unsubscribe https://github.com/notifications/unsubscribe-auth/ABQPFNSM2EFFR6DLUPYQCY3WZZFGBANCNFSM6AAAAAAVLD57KQ . You are receiving this because you are subscribed to this thread.Message ID: @.***>
How to remove the * character at the end of the sequences
Hi, I ran this command "./run-GOMAP-SINGLE.sh --step=seqsim --config=test/config.yml" on PBS script and error file show this : "The input sequences contain non IUPAC amino acid characters"
How to fix it? This is my sequence