This is a code repository for the SIB - Swiss Institute of Bioinformatics CALIPHO group neXtProt project
See: https://www.nextprot.org/
The sequence viewer is a super easy javascript library to use in order to draw a protein sequence in a readable way.
Live demo: https://cdn.rawgit.com/calipho-sib/sequence-viewer/master/examples/index.html
Simple example: https://cdn.rawgit.com/calipho-sib/sequence-viewer/master/examples/simple.html
1) Include the library using NPM/Yarn
//NPM//
npm install sequence-viewer
//YARN//
yarn add sequence-viewer
Or Include the feature-viewer from jsDelivr CDN in the header of your html
<script src="https://cdn.jsdelivr.net/gh/calipho-sib/sequence-viewer@v1.0.0/dist/sequence-viewer.bundle.js"></script>
NOTE : If you already got the dependencies (Bootstrap & Jquery) in your project, use the simple minified version instead of the bundle :
<script src="https://cdn.jsdelivr.net/gh/calipho-sib/sequence-viewer@v1.0.0/dist/sequence-viewer.min.js"></script>
2) Specify a div in your html
<div id="sequence-viewer"></div>
3) Create an instance of Sequence in JavaScript and apply the render method
var seq = new Sequence('MALWMRLLPLLALLALWGPGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN');
// Render the sequence with or without rendering options
// (Check the interactive documentation)
seq.render('#sequence-viewer');
To import Sequence Viewer into an ES2015 application, you can import specific symbols from specific Sequence Viewer modules:
import Sequence from "sequence-viewer";
4) Et voila!
Note: if you choose the later approach with only the main javascript you should also include the dependencies, jquery,handlebars and bootstrap.min.css
Check out this interactive page for a better understanding of how to use the sequence viewer and its possibilities :
https://search.nextprot.org/entry/NX_P01308/structures
If you have any problem or suggestion please open an issue here.
git clone https://github.com/calipho-sib/sequence-viewer.git
npm install
(will install the development dependencies)
npm start
(will start the development server on localhost:8080)
...make your changes and modifications...
npm run build
(will create the bundle js & css in build/)
npm publish
(will publish in npm)
This software is licensed under the GNU GPL v2 license, quoted below.
Copyright (c) 2015, SIB Swiss Institute of Bioinformatics