ViromeSummaryTable: Filter displayed output by Column per Node Type

[ababaian]

Currently when you click on a virus node or run node, the same format of table is shown, only the rows displayed are filtered differently.

Click Virus

Click Run

---

The table columns are listed below. They are highly redundant for certain node types, so they should be adjusted to display different sets of columns per type:

• run
• scientific_name
• bio_sample
• bio_project
• palm_id
• sotu
• nickname
• gb_acc
• gb_pid
• gb_eval
• tax_species
• tax_family
• node
• node_coverage
• node_pid
• node_eval
• node_qc
• node_seq

---

Virus Node Columns

Display runs-edges

• run
• scientific_name
• bio_sample
• bio_project
• palm_id
• node_coverage
• node_pid
• node_eval
• node_seq

---

Run Node Columns

Display virus-edges

• palm_id
• sotu
• nickname
• node_coverage
• gb_acc
• gb_pid
• gb_eval
• tax_species
• tax_family
• node
• node_pid
• node_eval
• node_seq

---

Edge Columns

For edges, they each represent a single contig (ambiguously called a node by assembly software). The view here should display a fasta format file of the form:

>{run}_{sotu}_coverage_{node_coverage}
{node_seq}

for example

>DRR001926_u45347_coverage_2
FSYDLKSATDRWPPVFMFETLALLFDRSFASSVVNTTLGTNLFEVPFVKRALSQVSFVTGQPLVPYGYWPLFAFTHHVLVWWAAEQVRPGILFDRYAILGDDVLI

[ababaian]

Edge Fasta file and BLAST search added in PR