-
## Expected Behavior
Custom database created for dbCAN v8.
## Current Behavior
Error during the `cstranslate` step.
## Steps to Reproduce (for bugs)
```
# creating custom dbCAN hhsuit…
-
I tried to run AlphaFold latest version on a new machine with **GPU RTX4090, CUDA version 11.8 (downgraded from 12.2), Ubuntu 22.04 LTS.** I used anaconda3 to build the alphafold environment. However,…
-
Hi,
I'm running alphafold 2.3.2 through singularity
```
/usr/bin/time run_alphafold_singularity.py --fasta-paths protein.fasta --output-dir ./norelax_2.3.2 --cpus=$SLURM_CPUS_PER_TASK --gpu-devices…
-
## Expected Behavior
MAC realignment algorithm is enabled by default in hhsearch/hhblits/hhalign and
it's expected to improve the quality of hits' alignments.
## Current Behavior
In some c…
-
Hello,
Fantastic work and thank you so much for releasing this to the public! I have encountered several issues with running trRosetta2 on Ubuntu:
1) some dependencies, like scikit learn had to be…
-
I am trying to create a HHblits database using the output of mmseqs2. Using this process (as written on the wiki)...
```bash
mmseqs search DBquery DBtarget searchOut tmp -a
mmseqs result2msa DBqu…
-
-
i am running alphafold v2.3.2 to predict a multimer on 16CPU,241G,4* V100
```
>3JA9_1|Chains A|Proliferating cell nuclear antigen|Homo sapiens (9606)
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHV…
-
Hi,
We have deployed our own MMSEQS2 server on a p4d.24xlarge AWS instance, running the server with all data residing in memory post vmtouch command and using the Alphafold2_batch.ipynb notebook t…
-
**Description:**
Running inference with the enable_workflow (Ray Workflow) option causes all processes to be pinned to a single core.
**Steps to Reproduce:**
Follow the conda or container install…