-
Hello,
It is a question rather than issue. In README it is written that we can use ascend with read counts or UMI counts. I tried to perform clustering on Raw data , it gives me error to runPCA fir…
-
OpenCV V3.4.1 build error.
System information (version)
- OpenCV => 3.4.1
- Operating System / Platform => Ubuntu 16.04 - 64 bit
- Compiler => native
cmake -D CMAKE_BUILD_TYPE=RELEASE -D CM…
-
I have 2 different python version and cuda9.0 and cuda 9.2
For a project I need to install opencv 2.4.9 on python2.7.
I had already installed opencv version 3. Right now uninstalled it.
But I get…
-
@ararslan has indicated an incorrect bot action in https://github.com/JuliaStats/MultivariateStats.jl/pull/47
The relevant snippets are shown below:
```diff
@@ -20,17 +20,17 @@ decentralize(x::Abstra…
-
Hello,
I rune muse 2.1.2-3, on Debian stretch. https://packages.debian.org/en/stretch/muse
When I start muse I get a message about the timer that is 250Hz while it must be 500Hz.
Muse fallba…
-
In the appended file I've written down some ideas on getting throughput way past the GB/s region that @sk1p and I had discussed. What do you think?
[Ideas for scalable architecture.docx](https://gith…
-
This is a list of typos in Chapter 12, version as of 30/06/18.
L. 4958: such as the EM algorithm [and] a latent variable // (not sure what should go in the bracket, but there should be something)
…
-
- OpenCV => 4.1
- Operating System / Platform => OSX 10.13.6
- Compiler => g++ (MacPorts gcc8 8.3.0_0) 8.3.0
##### Detailed description
Cannot compile cpu_ssse3.cpp and more. Full cmake error…
-
## Expected Behavior
Some identical sequence must be clustered together.
For example in the pan.fasta file :
```
>GCF_001259475.1_4370_2_2_genomic_00977
MFSNLKHVVMLMLLASAASYALAAPAPVSDLGSNVSGGSR…
-
Para cada artigo sleecionado pela @lorebueno verificar se tratam de Portfólio e a abordagem de PCA. Após a seleção escrever os parágrafos em Inglês (para cada artigo) respondendo:
1) Quem fez ?
2) Q…