-
Hello,
I am trying to draw a complex glycan containing a Fuc with 3 substituents (2x O-Me on positions 2 and 4 and NH2 on pos 3) and export the drawing to WURCS format, but I get an error message:
…
-
Issue: Note the missing data on the right side of my box.
I can see how it might b…
-
## Summary
The `paho.mqtt.client.Client.connect()` function call always returns zero, even on failed connections.
If the intention is to use the `on_connect` and `on_disconnect`callbacks, then sur…
-
## Expected Behavior
I would like to reuse a template folder for multiple ColabFold runs.
So I run ColabFold first on the following input sequence:
`>seq
EIVLTQSPGTQSLSPGERATLSCRASQSVGNNKLAWYQQR…
-
Hi
I have used pdb2pqr before but only for proteins, never for ligands.
I want to produce a .pqr file and APBS input for a ligand only ie no protein.
I tried the following command
pdb2p…
-
Dear sir:
I have no problem running a single plass job on my Linux cluster. However, I want to try for mpi plass job. Here are the details for the input and logs files.
I specify two nodes with e…
-
Hi. I want to work with an 8 aminoacids peptide contain Amine and Acetyl group at C and N-terminal, respectively. Before anything, I create amine and acetyl parameters by antechamber and add obtained …
-
## Expected Behavior
Successful create a search resultDB when run `mmseqs search query/queryDB target/tragetDB search/resultDB -s 7.5 --search-type 3`
but fail when run `mmseqs search query/queryDB…
-
## Expected Behaviour
Unknown
## Current Behaviour
I am trying to re-create the clustered nr database currently featured on the BLAST site. The cluster step appears to stall after merging the…
cef61 updated
2 months ago
-
When I created keybase.io account I played with it a bit, trying how things works, how it checks your claims...
When I tried to claim hackernews account from complete stranger with curl/GPG/bash meth…