-
In tech team meeting today, we discussed prioritizing certain Sequencing Read Archive samples and I suggested that prioritizing by organism may be one way to go about that. There were questions about …
-
I freshly installed the pca branch to test out the new `hicTransform -me norm` for _Drosophila melanogaster_ genome, sadly enough, no output is created although there are no error messages, only warni…
-
_(Edited the initial issue to add all problems_
Hello,
I found several issues with the aliases functionality (and bulk_update feature).
1. Error in the tripal job when using the bulk aliases up…
-
1. Run HHpred with the following sequence:
>d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
PNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTSSSTALAHKQNHKTITAKDILQTLTEL…
-
Currently, it's annoying to have to dig through the `references:` section of the config, especially if you only want one or a handful of genomes.
I propose an "include" mechanism, where individual …
daler updated
6 years ago
-
Dear Andre,
How are you? Thanks for developing this tool, it looks quite promising.
I am trying to run spladder on some Drosophila melanogaster samples to infer about differential expression at the i…
ghost updated
6 years ago
-
Just ran into an issue while committing my fork of intermine. These were large files(>50MB and already deleted physcially) that remains in the git history. Here is a report ..
```
Filename …
-
```
2015-06-25 15:34:33 ERROR org.intermine.webservice.server.WebService - Service failed by internal error. Request parameters:
query:
summaryPath: Gene.overlappingFeatures.dataSets.id
format: …
-
Hi,
I was thinking of doing an iterative scaffolding of my contig assembly using abyss, mainly because then I have more control on the usage of different libraries (and technologies) I have at hand…
-
@rachellyne FlyMine has 117,000 chromosomes for the Drosophilas.
These have associated data so we just can't not load them (or can we?!).
What should we do?
1. not load them. only load the "…