-
*Issue migrated from trac ticket # 5790*
**component:** help | **priority:** blocker
#### 2021-03-20 19:59:34: joanne.m.yancon@thermofisher.com created the issue
___
> Thermo Fisher Scientific is …
-
Hello,
I am trying to cluster pdbs with several chains, in this case they are all dimers (antibodies).
I have not found whether or not foldseek would allow that but since I could run latest fold…
-
Hi,
I am using GPT-3.5-Turbo for the Clinfo API, but I run into a "context length exceeded" error from OpenAI for some queries. Is it possible to control the size of the context being used for thes…
-
1. **Lab Name**: **Immunology Virtual Lab I**
2. **List of Experiments and Repositories**:
Collection of Serum from Blood
https://github.com/virtual-labs/exp-serum-from-blood-au
v1.0.0
…
-
anarci supports 2 domains in one sequence, while abnumber does not
abnumber.exceptions.ChainParseError: Found 2 antibody domains in sequence: "DIQLTQSPSFLSASVGDRVTITCSARSSISFMYWYQQKPGKAPKLLIYDTSNLA…
-
For the Koenig and Warszawski sets, I have been trying to find out what the fitness values actually represent. They are surely not KD values in nM as labeled. At least for the Koenig set, your 'fitnes…
-
Teď funguje tak, že máme
```python
@dataclass
class AntibodyMatchForHLAType: # TODO: možná lepší název bude AntibodyMatchForAssumedHLATypes
assumed_hla_types: List[HLATypeWithFrequency]
…
-
Kristian just explained what's going on in [this](http://journals.plos.org/ploscompbiol/article?id=10.1371/journal.pcbi.1004870) paper, and it turns out to be precisely what we need to do with unseede…
-
Based on feedback, using our baseline expression data to provide a facet filter that allows you to filter targets expressed (or selectively expressed) in specific tissues/cell types would be interesti…
-
Hello,
I was following the "Pratope-epitope Docking using AbDock" pipeline inside the AbDock folder. When executing the script optimize_ab.py, the following error came up:
$ python optimize_ab.py…