-
## 🚀 Feature
Right now although many of our layers (`Image`, `Labels`, `Points` etc.) support 3D rendering, interactivity in 3D (i.e. painting, picking, adding points) has yet to be fully explored or…
-
Hi there,
I am a student new to cryo-EM. I am now trying to apply IsoNet on the analysis of my data and I have encountered a problem.
I found that it took extremely long time in the refine step …
-
Run the partial hallucination using the following code and got out of memory issue. the complex is composed of two chains ['A', 'C'], A chain has 1505 residues. Need to repaired side chain structure u…
-
Hey,
I have a fasta file where certain residues are unknown and therefor represented with `X`
such as (1 at the start and 1 at place 105):
```
>chain 'CM'
XPFKRFVEIGRVALVNYGKDYGRLVVIVDVVDQNRAL…
sroet updated
9 months ago
-
Please make suggestions for informative README.md files
- [x] landing page readme
- [x] notebook readme
-
I am getting the following error in several EM maps.
Traceback (most recent call last):
File "/home/fpdeisidro/app/qscore/qscore/run_qscore.py", line 35, in
main(parsed_args)
File "/ho…
-
It is useful to know who is using scikit-image when planning funding proposals. I was looking a little into how one can extract information such as that presented in [GitHub's dependents view](https:/…
-
If you see something uncommon please report here
-
-
Just saw this tweet announcing a human brain MRI at 100µm isotropic resolution. This could be a very cool dataset to use as a napari demo. I suggest we use this issue to keep track of datasets that we…