-
**Describe the bug**
The agg function produces this error when the overlapping age group (age start =0, age end = 11) is included in the dataset.
`Error in subtrees[[i]]: subscript out of bounds`
…
-
Hello I want to run "kendall" correlation, but when I look at the variable in RStudio it still says Pearson?
```
library(correlation)
myPerms
-
When we run coverm:
```shell
/home1/jialh/anaconda3/envs/MAG/bin/coverm contig \
-t 8 -r /home1/jialh/brain/CAGs/CAGs/cdhit_rep_seq.fna \
-1 /home1/jialh/brain/JPN/preprocessing/01_processing/05…
-
Hi! Thanks for the cool tool!
When I start from estimated read counts from a different pipeline (STAR > featureCounts) should I provide Taiji with raw reads or should I normalise them somehow before …
-
## Expected Behavior
## Current Behavior
Here's the `rep_seq.fasta` file:
```
>protein_A
MKNNSQDQQKLLKLLLQKKGISFKKVNTIPKRQSSNSELIPISLTQLELWFFAQFYPENC
IYNLPCIYRIEGLLNVPALEESLREIVKRHESLRTTFTCI…
-
### Description
In the example I am testing (stimulated by [this SO question](https://stackoverflow.com/q/61207545/2726543), the function which takes less time is ranked 'b' instead of 'a'.
### …
-
Hi,
I am trying to annotate two group specific point in the picture. However, it doesn't seem to work properly . Please see examples below:
p
-
Using `mergeCells` can be very slow when doing many merges. This is caused by a check for overlapping merges. This is done by extracting all affected fields from all previous merges and by checking if…
-
### What version of Racket are you using?
6.6.0.1 -
### What program did you run?
https://gist.github.com/wargrey/b4467a975346b98b1210014a07b765d0 (schema.rkt for testing)
### If you got an error me…
-
Dear all,
thank you very much for making the code and weights available as well as providing installation instructions etc.
I tried to fetch the databases, but hit a bump in between.
As you can…