-
### Steps To Reproduce
Running on [SageMathCell](https://sagecell.sagemath.org/?z=eJzz1rOpslOwVfArzU1KLXLLTM1J0aiIM1HQVTC00KqIM1LQVrDU5OXy9waq8dYrysxLj89Pi8_MK0lNTy0q1gBKBQBl_L31MlNSE3M0jIECicXFqUU…
-
When you run easy search and output the pident/fident columns, is this sequence similarity (what you would get from mmseqs2/blast) or structure-sequence similarity (using the 3Di)?
Also, how can I …
-
Hello
The error message, "CRITICAL: No target sequence remained after merging structure files, no further normalization will be made," indicates that there is an issue related to merging structure fi…
-
## errors:
(humatch) [test@localhost Humatch]$ Humatch-classify -H QVQLVQSGAEVNKPGASVKVSCKASGYTFTGYVVHWVRQAPGQRLEWMGWINTGNGDTKYSQKFQGRVSITRDTSANTAYMEVSTLRSEDTAVYYCARDRGGSGDFDYWGQGTLVTVSS -L EIVLTQSPV…
-
### Is your feature request related to a problem? Please describe.
Yes, when interacting with perplexity.ai, I encountered a BadRequestError with the following message:
```
BadRequestError: Err…
-
Hi,
When we are managing the molecules in the Trace processing portion, there will be times when we will attempt to look at a molecule (ex: molecule 88) and we recieve an an error like this:
![image…
-
Currently, we manually calculate a [sinebow](http://basecase.org/env/on-rainbows) in App.js for use in Detail view to color DNA/RNA/protein sequences by position. Perhaps a better option would be to u…
-
> Convolutional neural networks (CNNs) have been shown to perform exceptionally well in a variety of tasks, including biological sequence classification. Available implementations, however, are usuall…
-
With pin screen:
![Log in](https://user-images.githubusercontent.com/49920406/85771394-8c5f8f80-b724-11ea-9906-8b4852554166.jpg)
Without (most likely option):
![Log in(2)](https://user-images.git…
-
Work to be done section:
-Multi-sequence compare tools from the broad institute.
IGV: https://software.broadinstitute.org/software/igv/download
Some good command line softwares you will inevit…