-
There is a stark difference in the time taken to compute MSA on Colab vs through AlphaFold's actual implementation through docker. I was trying to figure out the differences, and the most obvious seem…
-
hello ! I've got a problem with ColabFold: AlphaFold2 using MMseqs2 , when I use the sequence of a-synuclein (MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSI…
-
Hello, how would I be able to tell if the GPU is used during the computation?
There are some warnings seen during initialization in the output below, I am unable to interpret them.
I see CPU is hi…
-
### Status of the documentation web page
- Need to rebalance between "Seamless explained" and feature documentation for several features. The former should be more conceptual, the latter more practic…
-
Hi,
I am trying to run PEPPI on a local machine (linux), using 3 protein sequences as a test run.
I have installed/compiled from source psipred (psipred.4.02.tar.gz) and blast (blast-2.2.9-amd6…
-
I have tried running every module and end up with similar errors every time. The docker worked very well a few months ago, but something has changed which is very surprising given the idea of containe…
smped updated
4 years ago
-
:exclamation: Make to check out our [User Guide](https://github.com/soedinglab/hh-suite/wiki).
## Expected Behavior
addss.pl should generate files that contain
> >ss_pred, >ss_conf, and >ss_ds…
-
I installed hh-suite in linux x86_64 and have been successfully using the HHblits function.
I use uniclust30_2018_08 to generate the multiple sequence alignment file .a3m.
Then use .a3m file to se…
-
I have installed Alphafold in locally. What does it mean ? Still running.
I have installed Alphafold in locally. What does it mean ? Still running.
--template_mmcif_dir: Path to a directory wi…
-
Run " run_pyrosetta_ver.sh example/input.fa . ",
Running HHblits
Running PSIPRED
Running hhsearch
Predicting distance and orientations
Running parallel RosettaTR.py
Running DeepAccNet-msa
Pi…