-
## Expected Behavior
According to the documentation, when extracting the representative sequences either by manually performing these steps:
```
mmseqs result2repseq DB clu clu_rep
mmseqs resu…
-
Hello all,
I am struggling figuring thing out as to what are the recommended settings for FALCON, and how to use it locally on a large SMP node (64-128 cores). I've found tutorials, but the logs s…
-
I tried running the assembly portion and got an error that it doesn't recognize an option set in Jellyfish. This isn't something I designate so not really sure how to address. Any ideas?
/REPde…
-
Hello,
(A) I used Single node to run wtdbg with ath data, the I get the results:
total length: 132015737, Max_length: 1433722, N50_len: 198115
(B) I used Multi node to run the kbm alignment acc…
-
## Expected Behavior
Some identical sequence must be clustered together.
For example in the pan.fasta file :
```
>GCF_001259475.1_4370_2_2_genomic_00977
MFSNLKHVVMLMLLASAASYALAAPAPVSDLGSNVSGGSR…
-
Hi,
The example E.coli data runs perfectly, both using the .sh file and running the commands individually. However, I have tried with at least a dozen of my own fastq files from multiple independent…
-
Hi everyone,
I am running trinity with the following command:
Trinity --seqType fq --max_memory 50G --left /home/mariamoteiro/Resultados_Trim_16_102/0_mM_KNO3_plus_1.trimP.fastq.gz,/home/mariamo…
-
Hi,
I get this error repeately. What does it mean, and how can I fix it?
[spades.log](https://github.com/ablab/spades/files/1937799/spades.log)
[params.txt](https://github.com/ablab/spades/files…
-
## Expected Behavior
I am trying to run mmseqs cluster with the MPI runner option across two nodes (master, slave), but I am unable achieve this effect. I have configured passwordless ssh from master…
-
I was interested in trying the algorithm LINCLUST for _de novo_ clustering of a set of nucleotide sequences (transcripts). I found that easy-cluster was the easiest to start with as it can take the fa…