-
Hello, I am trying to run colabfold_batch with amber relax and AlphaFold-multimer to generate antibody structures.
When I run regular colabfold (through the notebook) the correct structure is gener…
-
## Expected Behavior
The two fasta files depicted below are identical except for the deflines:
`pass.fasta`
```
>zzsomething
MPELRRVLANGVELNVALCGSGPAVLLLHGFPHTWELWTDVMADLSGRYRVIAPDLRGFGASGR…
-
Hi Mike,
I only got **86%** of the way through this time:
[Thu Nov 4 02:02:55 2021]
Finished job 1885.
1894 of 2200 steps (86%) done
Exiting because a job execution failed. Look above for er…
-
Hello,
I'm trying to run createdb but got the following error message. I have tried with less FASTA files as input but I still got the same message.
## Expected Behavior
createdb works without …
-
## Expected Behavior
running blastp-like search against TrEMBL
## Current Behavior
Crash at prefilter stage
## Steps to Reproduce (for bugs)
mmseqs search tmpDir/tmp_Juil.D465_1000nt.fa…
-
Hello team，
is the newest 200 million uniprot structure by alphafold available？
Thanks，
Jianshu
## Expected Behavior
## Current Behavior
## Steps to Reproduce (for bugs)
Pleas…
-
Hi Jens,
Thank you for developing such great software! I try to use GeMoMa to annotate my genome with 5 reference species from Ensembl. But after running for a several hours, I encountered th…
-
Hi, thanks for your work on Struo2!
I have a set of MAGs and I want to use Struo2 to make a new Kraken database with genome sequence, and update the current HUMAnN3 with gene set (which I get by runn…
-
## Expected Behavior
First of all, thanks for making the new Uniprot structures available as indices so quickly! Having a 70Gb is a lot less to download than 23Tb - amazing :)
First test: I am h…
-
Dear foldseek developers,
When I search the 2ekj_A against PDB database with the default settings (3Di/AA), in the html output, I find the 2ekj_A as the first hit and I don't see it anymore in t…