-
Hello,
I am using v2.3.1 of alphafold. I've installed it inside conda environment by combining your conda instructions with the https://github.com/deepmind/alphafold/archive/refs/tags/v2.3.1.tar.gz…
-
Hello
running the above commands yields:
stdout:
```
Running HHblits
Running PSIPRED
Running hhsearch
Running rMSA (lite)
Running RoseTTAFold2NA to predict structures
Running on GPU
…
-
Hey all,
Is there any publicly available script to parse an HHR output file from HHblits? I can't seem to awk/sed my way through the output to get the top hit(s). I would appreciate it if someone cou…
-
Running into a few dependency build issues:
```
Scanning dependencies of target ffindex_apply
[ 29%] Building C object lib/ffindex/src/CMakeFiles/ffindex_modify.dir/ffindex_modify.c.o
[ 30%] B…
-
:exclamation: Make to check out our [User Guide](https://github.com/soedinglab/hh-suite/wiki).
## Expected Behavior
make & install hh-suite
## Current Behavior
error in make on iOS 13.0
## Step…
-
I have recently realized that hh-suite has removed support for HMMER files completely. I was wondering if there was a utility to convert HMMER format to the new HHSearch format, or even some kind of g…
-
I got error message when "pip install 'openfold @ git+https://github.com/aqlaboratory/openfold.git@4b41059694619831a7db195b7e0988fc4ff3a307'"
Here is the error message:
pip install 'openfold @ git+h…
-
This is most likely some kind of local configuration error, but I haven't been able to pin down the cause. If anyone has encountered this behavior before or has an idea of what might be wrong based on…
-
Excellent work!
I'm trying to run inference process of openfold.
My input fasta is :
>HBA_HUMAN
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVN…
-
When I try to run:
python3 docker/run_docker.py --left_pdb_filepath project/test_data/4heq_l_u.pdb --right_pdb_filepath project/test_data/4heq_r_u.pdb --input_dataset_dir project/datasets/CASP_CAPRI …